KEGG   Homo sapiens (human): 79840Help
Entry
79840             CDS       T01001                                 

Gene name
NHEJ1, XLF
Definition
nonhomologous end-joining factor 1
Orthology
K10980  
non-homologous end-joining factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Non-homologous end-joining
Disease
H00924  
Severe combined immunodeficiency with microcephaly, growth retardation, and sensitivity to ionizing radiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    79840 (NHEJ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q35
AA seq 299 aa AA seqDB search
MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKE
LNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWN
FHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLK
TEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHT
SNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLFS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactggagcaaggcctgttgatgcagccatgggcgtggctacagcttgcagag
aactccctcttggccaaggtttttatcaccaagcagggctatgccttgttggtttcagat
cttcaacaggtgtggcatgaacaggtggacactagtgtggtcagccagcgagccaaggag
ctgaacaagcggctcactgctcctcctgcagctttcctctgtcatttggataatctcctt
cgcccattgttgaaggacgctgctcaccctagcgaagctaccttctcctgtgattgtgtg
gcagatgcactgattctacgggtgcgaagtgagctctctggcctccccttctattggaat
ttccactgcatgctagctagtccttccctggtctcccaacatttgattcgtcctctgatg
ggcatgagtctggcattacagtgccaagtgagggagctagcaacgttacttcatatgaaa
gacctagagatccaagactaccaggagagtggggctacgctgattcgagatcgattgaag
acagaaccatttgaagaaaattccttcttggaacaatttatgatagagaaactgccagag
gcatgcagcattggtgatggaaagccctttgtcatgaatctgcaggatctgtatatggca
gtcaccacacaagaggtccaagtgggacagaagcatcaaggcgctggagatcctcatacc
tcaaacagtgcttccctgcaaggaatcgatagccaatgtgtaaaccagccagaacaactg
gtctcctcagccccaaccctctcagcacctgagaaagagtccacgggtacttcaggccct
ctgcagagacctcagctgtcaaaggtcaagaggaagaagccaaggggtctcttcagttaa

DBGET integrated database retrieval system