KEGG   Homo sapiens (human): 79861Help
Entry
79861             CDS       T01001                                 

Gene name
TUBAL3
Definition
(RefSeq) tubulin alpha like 3
  KO
K07374  tubulin alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04210  Apoptosis
hsa04530  Tight junction
hsa04540  Gap junction
hsa05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    79861 (TUBAL3)
  Cell growth and death
   04210 Apoptosis
    79861 (TUBAL3)
  Cellular community - eukaryotes
   04530 Tight junction
    79861 (TUBAL3)
   04540 Gap junction
    79861 (TUBAL3)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    79861 (TUBAL3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     79861 (TUBAL3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     79861 (TUBAL3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    79861 (TUBAL3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   79861 (TUBAL3)
  Exosomal proteins of other body fluids (saliva and urine)
   79861 (TUBAL3)
  Exosomal proteins of colorectal cancer cells
   79861 (TUBAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 79861
NCBI-ProteinID: NP_079079
HGNC: 23534
Ensembl: ENSG00000178462
Vega: OTTHUMG00000017595
Pharos: A6NHL2(Tdark)
UniProt: A6NHL2
Position
10p15.1
AA seq 446 aa AA seqDB search
MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLENAKMEHTNASFDTFF
CETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYSVGSE
VIDLVLERTRKLAEQCGGLQGFLIFRSFGGGTGSGFTSLLMERLTGEYSRKTKLEFSVYP
APRISTAVVEPYNSVLTTHSTTEHTDCTFMVDNEAVYDICHRKLGVECPSHASINRLVVQ
VVSSITASLRFEGPLNVDLIEFQTNLVPYPRIHFPMTAFAPIVSADKAYHEQFSVSDITT
ACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKSRHSVQFVDWCPTGFKV
GINNRPPTVMPGGDLAKVHRSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLREGM
EEAEFLEAREDLAALERDYEEVAQSF
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagggagtgcctttccatccacatcggtcaagctggcatccagattggggacgcctgc
tgggaactctattgcctggaacatggaatccagccaaatggcgttgttcttgacactcaa
caggatcagctggaaaatgcaaaaatggagcacacaaatgcatctttcgataccttcttc
tgtgagacaagagctgggaagcatgtgcctagagcactcttcgtggacttggagccaact
gttatagatgggatccggacgggccagcaccgttcactcttccaccccgagcagctcctt
agcggaaaggaggatgctgctaacaattacgcgcgaggccgttactctgtggggtcggag
gtcatcgaccttgtgctggagaggacccggaagctggcagaacagtgtggtggacttcag
ggatttttgattttccgaagctttggaggaggcactggttcagggtttacgtctctctta
atggagaggctcacaggagaatatagcagaaagactaagctggagttctcggtctaccca
gcccccaggatctccactgctgtggtagagccttataactctgtcctcaccacccactcc
accacagagcacacggactgtaccttcatggtggacaacgaggccgtctatgatatatgc
catcgtaaactcggtgttgaatgcccctctcatgccagcatcaatagattggtggttcag
gtggtatcttccatcactgcctccctccggtttgaagggcccttgaatgtagacctaatt
gaattccagaccaacctggtaccttatccgagaatacatttccccatgacagccttcgcc
cccatcgtctctgctgacaaagcctaccatgagcagttctctgtgtcagacatcaccact
gcctgctttgagtcctccaaccagctggtcaagtgtgatcctcggcttgggaagtacatg
gcctgctgcctactctatagaggggatgtggtccccaaggaagtgaatgcagcaatcgca
gccacgaagtcgaggcactctgttcagtttgtagattggtgtccaactggtttcaaggtg
ggcatcaacaatcggccgcccacggtgatgccgggtggggacctggccaaagtccaccgg
tccatctgcatgctgagcaacaccacggcgattgtggaggcctgggcccgcctggaccac
aagtttgacctcatgtacgccaagagagcatttctgcactggtacctcagagaaggcatg
gaagaagcagagttcttggaggccagggaagatctggcagccctggagagggactatgag
gaagtggcgcaaagtttctga

DBGET integrated database retrieval system