KEGG   Homo sapiens (human): 79861Help
Entry
79861             CDS       T01001                                 

Gene name
TUBAL3
Definition
tubulin, alpha-like 3
Orthology
K07374  
tubulin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    79861 (TUBAL3)
  Cellular commiunity
   04540 Gap junction
    79861 (TUBAL3)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    79861 (TUBAL3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   79861 (TUBAL3)
  Exosomal proteins of other body fluids (saliva and urine)
   79861 (TUBAL3)
  Exosomal proteins of colorectal cancer cells
   79861 (TUBAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10p15.1
AA seq 406 aa AA seqDB search
MDQLENAKMEHTNASFDTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLL
SGKEDAANNYARGRYSVGSEVIDLVLERTRKLAEQCGGLQGFLIFRSFGGGTGSGFTSLL
MERLTGEYSRKTKLEFSVYPAPRISTAVVEPYNSVLTTHSTTEHTDCTFMVDNEAVYDIC
HRKLGVECPSHASINRLVVQVVSSITASLRFEGPLNVDLIEFQTNLVPYPRIHFPMTAFA
PIVSADKAYHEQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIA
ATKSRHSVQFVDWCPTGFKVGINNRPPTVMPGGDLAKVHRSICMLSNTTAIVEAWARLDH
KFDLMYAKRAFLHWYLREGMEEAEFLEAREDLAALERDYEEVAQSF
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggatcagctggaaaatgcaaaaatggagcacacaaatgcatctttcgataccttcttc
tgtgagacaagagctgggaagcatgtgcctagagcactcttcgtggacttggagccaact
gttatagatgggatccggacgggccagcaccgttcactcttccaccccgagcagctcctt
agcggaaaggaggatgctgctaacaattacgcgcgaggccgttactctgtggggtcggag
gtcatcgaccttgtgctggagaggacccggaagctggcagaacagtgtggtggacttcag
ggatttttgattttccgaagctttggaggaggcactggttcagggtttacgtctctctta
atggagaggctcacaggagaatatagcagaaagactaagctggagttctcggtctaccca
gcccccaggatctccactgctgtggtagagccttataactctgtcctcaccacccactcc
accacagagcacacggactgtaccttcatggtggacaacgaggccgtctatgatatatgc
catcgtaaactcggtgttgaatgcccctctcatgccagcatcaatagattggtggttcag
gtggtatcttccatcactgcctccctccggtttgaagggcccttgaatgtagacctaatt
gaattccagaccaacctggtaccttatccgagaatacatttccccatgacagccttcgcc
cccatcgtctctgctgacaaagcctaccatgagcagttctctgtgtcagacatcaccact
gcctgctttgagtcctccaaccagctggtcaagtgtgatcctcggcttgggaagtacatg
gcctgctgcctactctatagaggggatgtggtccccaaggaagtgaatgcagcaatcgca
gccacgaagtcgaggcactctgttcagtttgtagattggtgtccaactggtttcaaggtg
ggcatcaacaatcggccgcccacggtgatgccgggtggggacctggccaaagtccaccgg
tccatctgcatgctgagcaacaccacggcgattgtggaggcctgggcccgcctggaccac
aagtttgacctcatgtacgccaagagagcatttctgcactggtacctcagagaaggcatg
gaagaagcagagttcttggaggccagggaagatctggcagccctggagagggactatgag
gaagtggcgcaaagtttctga

DBGET integrated database retrieval system