KEGG   Homo sapiens (human): 79862Help
Entry
79862             CDS       T01001                                 

Gene name
ZNF669
Definition
(RefSeq) zinc finger protein 669
  KO
K09228  
KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    79862 (ZNF669)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q96BR6(Tdark)
UniProt: 
Position
1q44
AA seq 464 aa AA seqDB search
MVSGLRLASRSGEEGWLKPAVARLGPPRHRLRNLRTESPWRSRGSVLFCSGPGRAGRAAE
PLHPVCTCGRHFRRPEPCREPLASPIQDSVAFEDVAVNFTQEEWALLDSSQKNLYREVMQ
ETCRNLASVGSQWKDQNIEDHFEKPGKDIRNHIVQRLCESKEDGQYGEVVSQIPNLDLNE
NISTGLKPCECSICGKVFVRHSLLNRHILAHSGYKPYGEKQYKCEQCGKFFVSVPGVRRH
MIMHSGNPAYKCTICGKAFYFLNSVERHQRTHTGEKPYKCKQCGKAFTVSGSCLIHERTH
TGEKPYECKECGKTFRFSCSFKTHERTHTGERPYKCTKCDKAFSCSTSLRYHGSIHTGER
PYECKQCGKAFSRLSSLCNHRSTHTGEKPYECKQCDQAFSRLSSLHLHERIHTGEKPYEC
KKCGKAYTRSSHLTRHERSHDIEAGCSDSAYNPSTLGGQGVWIA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtggactgcgcctggcttcccgaagtggagaagagggctggttgaaacctgct
gtggcgcgactcgggcctccacgccatcggctccggaacctgcggaccgagtcgccgtgg
cgtagccggggctcagtcctcttctgttcagggccgggccgggcggggcgggcagcggaa
cccctgcatcctgtctgtacctgcgggcgccacttccgccggccggagccctgtcgggaa
cccctcgcctcccctatccaggactcggtggcttttgaggatgtggctgtgaactttacc
caggaggaatgggctttgctagattcttctcagaagaatctctacagagaagtgatgcag
gaaacctgcaggaacctggcttctgtaggaagccaatggaaagaccagaatattgaagat
cacttcgaaaaacctgggaaagatataagaaatcatatcgtacagagactgtgtgaaagt
aaagaagatggtcagtatggagaagttgtcagccaaattccaaatcttgatctgaacgag
aacatttctactggattaaaaccatgtgaatgcagtatttgtggaaaagtctttgtacgt
cattccctccttaataggcatatcctagctcactcaggatacaaaccatatggagagaag
caatataaatgtgaacagtgtgggaaattcttcgtttctgttccaggtgttagaagacac
atgataatgcacagtggaaatccagcttataaatgtacgatatgtgggaaagctttttat
tttctcaattcagttgaaagacatcagagaactcacacaggagaaaaaccctataaatgt
aaacaatgtggtaaagcattcactgtttccggttcttgtctaatacatgaacgaactcac
actggagagaaaccctacgaatgtaaggaatgtgggaaaacattcagattttcttgttct
tttaagacgcatgaaaggactcacactggagaaagaccctataaatgtaccaaatgtgat
aaagccttcagctgttccacttcccttcgttaccatggaagcattcatactggagagaga
ccctatgagtgtaaacaatgtggcaaagcctttagtcgtttgagttccctttgtaaccat
agaagtactcataccggagagaaaccctatgaatgtaaacaatgtgatcaagccttcagt
cgcctcagttcccttcacctccacgaaagaattcatactggagaaaaaccctatgaatgt
aagaaatgcggtaaagcctacactcgttccagtcaccttactcgccatgaaagaagtcat
gatatagaggctgggtgtagtgactcagcctataatcccagcactttgggaggccaaggc
gtgtggattgcttga

DBGET integrated database retrieval system