KEGG   Homo sapiens (human): 79869Help
Entry
79869             CDS       T01001                                 

Gene name
CPSF7, CFIm59
Definition
(RefSeq) cleavage and polyadenylation specific factor 7
  KO
K14398  
cleavage and polyadenylation specificity factor subunit 6/7
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    79869 (CPSF7)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor Im (CFIm)
     79869 (CPSF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q12.2
AA seq 471 aa AA seqDB search
MSEGVDLIDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPS
PKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA
NGQSKGYAEVVVASENSVHKLLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRECVRV
PRGGIPPRAHSRDSSDSADGRATPSENLVPSSARVDKPPSVLPYFNRPPSALPLMGLPPP
PIPPPPPLSSSFGVPPPPPGIHYQHLMPPPPRLPPHLAVPPPGAIPPALHLNPAFFPPPN
ATVGPPPDTYMKASAPYNHHGSRDSGPPPSTVSEAEFEDIMKRNRAISSSAISKAVSGAS
AGDYSDAIETLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEAKSYSVGASGSSSRKR
HRSRERSPSRSRESSRRHRDLLHNEDRHDDYFQERNREHERHRDRERDRHH
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaggagtggacttgattgatatatatgctgacgaggagttcaaccaggaccca
gagttcaacaatacagatcagattgacctgtatgatgatgtgctgacagccacctcacag
ccctcagatgacagaagcagcagcactgaaccacctcctcctgttcgccaggagccatct
cccaagcccaacaacaagacccctgcaattctgtatacctacagtggcctgcgtaataga
cgagctgccgtttatgtgggcagcttctcctggtggaccacagaccagcagctgatccag
gttattcgctctataggagtctatgatgtggtggagttgaaatttgcagagaatcgagca
aatggccagtccaaagggtatgctgaggtggtggtagcctctgaaaactctgtccacaaa
ttgttggaactcctaccagggaaagttcttaatggagaaaaagtggacgtgaggccggcc
acccggcagaacctgtcacagtttgaggcacaggctcggaaacgtgagtgtgtccgagtc
ccaagagggggaatacctccacgggcccattcccgagattctagtgattctgctgatgga
cgggccacaccctctgagaaccttgtaccctcatctgctcgtgtggataagccccccagt
gtgctgccctacttcaatcgtcctccttcggcccttcccctgatgggtctgcccccacca
ccaattccacccccaccacctctctcctcaagctttggggtccctcctcctcctcctggt
atccactaccagcatctcatgcccccacctcctcgattacctcctcatcttgctgtacct
ccccctggggccatcccacctgcccttcacctcaatccagccttcttccccccaccaaac
gctacagtggggcctccaccagatacttacatgaaggcctctgccccctataaccaccat
ggcagccgagattcgggccctccaccctctacagtgagtgaagccgaatttgaagatatc
atgaagcgaaacagagcaatttccagcagtgccatttccaaagcagtatctggagccagt
gcaggggattacagtgacgcaattgagacgctgctcacagccattgcggttatcaaacag
tcccgggttgccaatgatgagcgttgccgtgtcctcatctcctctcttaaggactgtctt
catggcatcgaagccaagtcctacagtgtgggtgccagtgggagctcttccaggaaaaga
catcgctcccgggaaaggtcacctagccggtcccgggagagcagcaggaggcaccgggat
ctgcttcataatgaagatcggcatgatgattatttccaagaaaggaaccgggagcatgag
agacaccgggatagagaacgggaccggcaccactga

DBGET integrated database retrieval system