KEGG   Homo sapiens (human): 79885Help
Entry
79885             CDS       T01001                                 

Gene name
HDAC11, HD11
Definition
(RefSeq) histone deacetylase 11
  KO
K11418  histone deacetylase 11 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Drug target
Belinostat: D08870
Entinostat: D09338
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tucidinostat: D10993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    79885 (HDAC11)
  Substance dependence
   05034 Alcoholism
    79885 (HDAC11)
  Infectious diseases
   05165 Human papillomavirus infection
    79885 (HDAC11)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     79885 (HDAC11)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     79885 (HDAC11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 79885
NCBI-ProteinID: NP_079103
OMIM: 607226
HGNC: 19086
Ensembl: ENSG00000163517
Vega: OTTHUMG00000129800
Pharos: Q96DB2(Tclin)
UniProt: Q96DB2 A0A024R2I1
Position
3p25.1
AA seq 347 aa AA seqDB search
MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDSML
VEAREASEEDLLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLRPLRTQTGG
TIMAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDL
DAHQGNGHERDFMDDKRVYIMDVYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLDKVER
NIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVKRDELVFRMVRGRRVPILMVT
SGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgctacacacaacccagctgtaccagcatgtgccagagacacgctggccaatcgtgtac
tcgccgcgctacaacatcaccttcatgggcctggagaagctgcatccctttgatgccgga
aaatggggcaaagtgatcaatttcctaaaagaagagaagcttctgtctgacagcatgctg
gtggaggcgcgggaggcctcggaggaggacctgctggtggtgcacacgaggcgctatctt
aatgagctcaagtggtcctttgctgttgctaccatcacagaaatcccccccgttatcttc
ctccccaacttccttgtgcagaggaaggtgctgaggccccttcggacccagacaggagga
accataatggcggggaagctggctgtggagcgaggctgggccatcaacgtggggggtggc
ttccaccactgctccagcgaccgtggcgggggcttctgtgcctatgcggacatcacgctc
gccatcaagtttctgtttgagcgtgtggagggcatctccagggctaccatcattgatctt
gatgcccatcagggcaatgggcatgagcgagacttcatggacgacaagcgtgtgtacatc
atggatgtctacaaccgccacatctacccaggggaccgctttgccaagcaggccatcagg
cggaaggtggagctggagtggggcacagaggatgatgagtacctggataaggtggagagg
aacatcaagaaatccctccaggagcacctgcccgacgtggtggtatacaatgcaggcacc
gacatcctcgagggggaccgccttggggggctgtccatcagcccagcgggcatcgtgaag
cgggatgagctggtgttccggatggtccgtggccgccgggtgcccatccttatggtgacc
tcaggcgggtaccagaagcgcacagcccgcatcattgctgactccatacttaatctgttt
ggcctggggctcattgggcctgagtcacccagcgtctccgcacagaactcagacacaccg
ctgcttccccctgcagtgccctga

DBGET integrated database retrieval system