KEGG   Homo sapiens (human): 79885Help
Entry
79885             CDS       T01001                                 

Gene name
HDAC11, HD11
Definition
histone deacetylase 11 (EC:3.5.1.98)
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p25.1
AA seq 296 aa AA seqDB search
MGLEKLHPFDAGKWGKVINFLKEEKLLSDSMLVEAREASEEDLLVVHTRRYLNELKRKVL
RPLRTQTGGTIMAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEG
ISRATIIDLDAHQGNGHERDFMDDKRVYIMDVYNRHIYPGDRFAKQAIRRKVELEWGTED
DEYLDKVERNIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVKRDELVFRMVRG
RRVPILMVTSGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggagaagctgcatccctttgatgccggaaaatggggcaaagtgatcaatttc
ctaaaagaagagaagcttctgtctgacagcatgctggtggaggcgcgggaggcctcggag
gaggacctgctggtggtgcacacgaggcgctatcttaatgagctcaagaggaaggtgctg
aggccccttcggacccagacaggaggaaccataatggcggggaagctggctgtggagcga
ggctgggccatcaacgtggggggtggcttccaccactgctccagcgaccgtggcgggggc
ttctgtgcctatgcggacatcacgctcgccatcaagtttctgtttgagcgtgtggagggc
atctccagggctaccatcattgatcttgatgcccatcagggcaatgggcatgagcgagac
ttcatggacgacaagcgtgtgtacatcatggatgtctacaaccgccacatctacccaggg
gaccgctttgccaagcaggccatcaggcggaaggtggagctggagtggggcacagaggat
gatgagtacctggataaggtggagaggaacatcaagaaatccctccaggagcacctgccc
gacgtggtggtatacaatgcaggcaccgacatcctcgagggggaccgccttggggggctg
tccatcagcccagcgggcatcgtgaagcgggatgagctggtgttccggatggtccgtggc
cgccgggtgcccatccttatggtgacctcaggcgggtaccagaagcgcacagcccgcatc
attgctgactccatacttaatctgtttggcctggggctcattgggcctgagtcacccagc
gtctccgcacagaactcagacacaccgctgcttccccctgcagtgccctga

DBGET integrated database retrieval system