KEGG   Homo sapiens (human): 799Help
Entry
799               CDS       T01001                                 

Gene name
CALCR, CRT, CT-R, CTR, CTR1
Definition
calcitonin receptor
Orthology
K04576  
calcitonin receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Osteoclast differentiation
Drug target
Calcitonin (salmon synthetic): 
Elcatonin: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.3
AA seq 508 aa AA seqDB search
MQFSGEKISGQRDLQKSKMRFTFTSRCLALFLLLNHPTPILPAFSNQTYPTIEPKPFLYV
VGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDF
DPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFT
LVISLGIFVFFRKLTTIFPLNWKYRKALSLGCQRVTLHKNMFLTYILNSMIIIIHLVEVV
PNGELVRRDPVSCKILHFFHQYMMACNYFWMLCEGIYLHTLIVVAVFTEKQRLRWYYLLG
WGFPLVPTTIHAITRAVYFNDNCWLSVETHLLYIIHGPVMAALVVNFFFLLNIVRVLVTK
MRETHEAESHMYLKAVKATMILVPLLGIQFVVFPWRPSNKMLGKIYDYVMHSLIHFQGFF
VATIYCFCNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQE
LRNEPANNQGEESAEIIPLNIIEQESSA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcaattttctggagagaagattagtggacaaagagatcttcaaaaatcaaaaatgagg
ttcacatttacaagccggtgcttggcactgtttcttcttctaaatcacccaaccccaatt
cttcctgccttttcaaatcaaacctatccaacaatagagcccaagccatttctttacgtc
gtaggacgaaagaagatgatggatgcacagtacaaatgctatgaccgaatgcagcagtta
cccgcataccaaggagaaggtccatattgcaatcgcacctgggatggatggctgtgctgg
gatgacacaccggctggagtattgtcctatcagttctgcccagattattttccggatttt
gatccatcagaaaaggttacaaaatactgtgatgaaaaaggtgtttggtttaaacatcct
gaaaacaatcgaacctggtccaactatactatgtgcaatgctttcactcctgagaaactg
aagaatgcatatgttctgtactatttggctattgtgggtcattctttgtcaattttcacc
ctagtgatttccctggggattttcgtgtttttcagaaaattgacaactatttttcctttg
aattggaaatataggaaggcattgagccttggctgccaaagggtaaccctgcacaagaac
atgtttcttacttacattctgaattctatgattatcatcatccacctggttgaagtagta
cccaatggagagctcgtgcgaagggacccggtgagctgcaagattttgcattttttccac
cagtacatgatggcctgcaactatttctggatgctctgtgaagggatctatcttcataca
ctcattgtcgtggctgtgtttactgagaagcaacgcttgcggtggtattatctcttgggc
tgggggttcccgctggtgccaaccactatccatgctattaccagggccgtgtacttcaat
gacaactgctggctgagtgtggaaacccatttgctttacataatccatggacctgtcatg
gcggcacttgtggtcaatttcttctttttgctcaacattgtccgggtgcttgtgaccaaa
atgagggaaacccatgaggcggaatcccacatgtacctgaaggctgtgaaggccaccatg
atccttgtgcccctgctgggaatccagtttgtcgtctttccctggagaccttccaacaag
atgcttgggaagatatatgattacgtgatgcactctctgattcatttccagggcttcttt
gttgcgaccatctactgcttctgcaacaatgaggtccaaaccaccgtgaagcgccaatgg
gcccaattcaaaattcagtggaaccagcgttgggggaggcgcccctccaaccgctctgct
cgcgctgcagccgctgctgcggaggctggcgacatcccaatttacatctgccatcaggag
ctgaggaatgaaccagccaacaaccaaggcgaggagagtgctgagatcatccctttgaat
atcatagagcaagagtcatctgcttga

DBGET integrated database retrieval system