KEGG   Homo sapiens (human): 79901Help
Entry
79901             CDS       T01001                                 

Gene name
CYBRD1, CYB561A2, DCYTB, FRRS3
Definition
(RefSeq) cytochrome b reductase 1
  KO
K08370  
cytochrome b reductase 1 [EC:1.16.5.1]
Organism
hsa  Homo sapiens (human)
Pathway
Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    79901 (CYBRD1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.5  With a quinone or similar compound as acceptor
    1.16.5.1  ascorbate ferrireductase (transmembrane)
     79901 (CYBRD1)
Transporters [BR:hsa02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   79901 (CYBRD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q31.1
AA seq 286 aa AA seqDB search
MAMEGYWRFLALLGSALLVGFLSVIFALVWVLHYREGLGWDGSALEFNWHPVLMVTGFVF
IQGIAIIVYRLPWTWKCSKLLMKSIHAGLNAVAAILAIISVVAVFENHNVNNIANMYSLH
SWVGLIAVICYLLQLLSGFSVFLLPWAPLSLRAFLMPIHVYSGIVIFGTVIATALMGLTE
KLIFSLRDPAYSTFPPEGVFVNTLGLLILVFGALIFWIVTRPQWKRPKEPNSTILHPNGG
TEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEAGQRSTM
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggccatggagggctactggcgcttcctggcgctgctggggtcggcactgctcgtcggc
ttcctgtcggtgatcttcgccctcgtctgggtcctccactaccgagaggggcttggctgg
gatgggagcgcactagagtttaactggcacccagtgctcatggtcaccggcttcgtcttc
atccagggcatcgccatcatcgtctacagactgccgtggacctggaaatgcagcaagctc
ctgatgaaatccatccatgcagggttaaatgcagttgctgccattcttgcaattatctct
gtggtggccgtgtttgagaaccacaatgttaacaatatagccaatatgtacagtctgcac
agctgggttggactgatagctgtcatatgctatttgttacagcttctttcaggtttttca
gtctttctgcttccatgggctccgctttctctccgagcatttctcatgcccatacatgtt
tattctggaattgtcatctttggaacagtgattgcaacagcacttatgggattgacagag
aaactgattttttccctgagagatcctgcatacagtacattcccgccagaaggtgttttc
gtaaatacgcttggccttctgatcctggtgttcggggccctcattttttggatagtcacc
agaccgcaatggaaacgtcctaaggagccaaattctaccattcttcatccaaatggaggc
actgaacagggagcaagaggttccatgccagcctactctggcaacaacatggacaaatca
gattcagagttaaacagtgaagtagcagcaaggaaaagaaacttagctctggatgaggct
gggcagagatctaccatgtaa

DBGET integrated database retrieval system