KEGG   Homo sapiens (human): 79901Help
Entry
79901             CDS       T01001                                 

Gene name
CYBRD1, CYB561A2, DCYTB, FRRS3
Definition
cytochrome b reductase 1
Orthology
K08370  
cytochrome b reductase 1
Organism
hsa  Homo sapiens (human)
Pathway
Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    79901 (CYBRD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q31.1
AA seq 157 aa AA seqDB search
MAMEGYWRFLALLGSALLVGFLSVIFALVWVLHYREGLGWDGSALEFNWHPVLMVTGFVF
IQGIASFRFFSLSASMGSAFSPSISHAHTCLFWNCHLWNSDCNSTYGIDRETDFFPERSC
IQYIPARRCFRKYAWPSDPGVRGPHFLDSHQTAMETS
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggccatggagggctactggcgcttcctggcgctgctggggtcggcactgctcgtcggc
ttcctgtcggtgatcttcgccctcgtctgggtcctccactaccgagaggggcttggctgg
gatgggagcgcactagagtttaactggcacccagtgctcatggtcaccggcttcgtcttc
atccagggcatcgcttctttcaggtttttcagtctttctgcttccatgggctccgctttc
tctccgagcatttctcatgcccatacatgtttattctggaattgtcatctttggaacagt
gattgcaacagcacttatgggattgacagagaaactgattttttccctgagagatcctgc
atacagtacattcccgccagaaggtgttttcgtaaatacgcttggccttctgatcctggt
gttcggggccctcattttttggatagtcaccagaccgcaatggaaacgtcctaa

DBGET integrated database retrieval system