KEGG   Homo sapiens (human): 7991Help
Entry
7991              CDS       T01001                                 

Gene name
TUSC3, D8S1992, M33, MRT22, MRT7, N33, OST3A
Definition
tumor suppressor candidate 3
Orthology
K12669  
oligosaccharyltransferase complex subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
Oligosaccharyltransferase
Disease
H00768  
Nonsyndromic autosomal recessive mental retardation (NS-ARMR)
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hsa00510]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p22
AA seq 348 aa AA seqDB search
MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWS
SRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSS
AFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAK
WIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVF
AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNE
AATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSDLDFE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccggggcgctccttcacgccgtaggcaagcggggcggcggctgcggtacctg
cccaccgggagctttcccttccttctcctgctgctgctgctctgcatccagctcggggga
ggacagaagaaaaaggagaatcttttagctgaaaaagtagagcagctgatggaatggagt
tccagacgctcaatcttccgaatgaatggtgataaattccgaaaatttataaaggcacca
cctcgaaactattccatgattgttatgttcactgctcttcagcctcagcggcagtgttct
gtgtgcaggcaagctaatgaagaatatcaaatactggcgaactcctggcgctattcatct
gctttttgtaacaagctcttcttcagtatggtggactatgatgaggggacagacgttttt
cagcagctcaacatgaactctgctcctacattcatgcattttcctccaaaaggcagacct
aagagagctgatacttttgacctccaaagaattggatttgcagctgagcaactagcaaag
tggattgctgacagaacggatgttcatattcgggttttcagaccacccaactactctggt
accattgctttggccctgttagtgtcgcttgttggaggtttgctttatttgagaaggaac
aacttggagttcatctataacaagactggttgggccatggtgtctctgtgtatagtcttt
gctatgacttctggccagatgtggaaccatatccgtggacctccatatgctcataagaac
ccacacaatggacaagtgagctacattcatgggagcagccaggctcagtttgtggcagaa
tcacacattattctggtactgaatgccgctatcaccatggggatggttcttctaaatgaa
gcagcaacttcgaaaggcgatgttggaaaaagacggataatttgcctagtgggattgggc
ctggtggtcttcttcttcagttttctactttcaatatttcgttccaagtaccacggctat
ccttatagtgatctggactttgagtga

DBGET integrated database retrieval system