KEGG   Homo sapiens (human): 79939Help
Entry
79939             CDS       T01001                                 

Gene name
SLC35E1
Definition
(RefSeq) solute carrier family 35 member E1
  KO
K15283  solute carrier family 35, member E1
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC35: Nucleoside-sugar transporter
   79939 (SLC35E1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPT EamA UAA TMEM234
Motif
Other DBs
NCBI-GeneID: 79939
NCBI-ProteinID: NP_079157
HGNC: 20803
Ensembl: ENSG00000127526
Vega: OTTHUMG00000152575
Pharos: Q96K37(Tdark)
UniProt: Q96K37 A0A024R7G7
Position
19p13.11
AA seq 410 aa AA seqDB search
MAAAAVGAGHGAGGPGAASSSGGAREGARVAALCLLWYALSAGGNVVNKVILSAFPFPVT
VSLCHILALCAGLPPLLRAWRVPPAPPVSGPGPSPHPSSGPLLPPRFYPRYVLPLAFGKY
FASVSAHVSIWKVPVSYAHTVKATMPIWVVLLSRIIMKEKQSTKVYLSLIPIISGVLLAT
VTELSFDMWGLVSALAATLCFSLQNIFSKKVLRDSRIHHLRLLNILGCHAVFFMIPTWVL
VDLSAFLVSSDLTYVYQWPWTLLLLAVSGFCNFAQNVIAFSILNLVSPLSYSVANATKRI
MVITVSLIMLRNPVTSTNVLGMMTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKER
HRSPLEKPHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNSYSLNRYDV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgcggtgggcgcgggccacggcgcggggggcccgggcgcagcgagcagc
agtggtggggcgcgcgagggcgcgcgggtggcggcgctgtgcctgctgtggtacgcgctg
agcgcgggcggcaacgtggtcaacaaggtgatcctgagcgccttcccgttcccggtgacc
gtgtcgctgtgccacatcctggctctgtgcgctgggctcccgccgctgctgcgcgcctgg
cgcgtgccccccgcgccgcccgtctcgggccccggacccagtccgcatccgtcgtccggc
ccgctgctgccgccgcgcttctacccgcgctacgtgctaccgctcgccttcggcaagtac
ttcgcgtccgtgtcagcgcacgtcagcatctggaaggtgcccgtgtcctatgcacacacc
gtcaaggccaccatgcccatctgggtggtcctcctgtcccggatcattatgaaggagaag
cagagcaccaaggtatacttgtcactcatccccatcatcagcggtgtcctgctggccacc
gtcaccgagttgtcttttgacatgtggggactcgtcagcgccctcgccgccacgctgtgc
ttctcgcttcagaacattttctccaaaaaggtcttgcgagattcacggatccaccatctc
cggctgctcaacatcctgggctgccacgccgtcttctttatgatccccacctgggttctg
gtggacctctcggctttcctggtcagcagcgacttgacctacgtctaccagtggccctgg
acgctcctgctcctggctgtcagcggcttctgtaactttgcccagaatgttatcgccttc
agcatcctcaacctcgttagccccctgagctactcggtcgccaatgccaccaaaagaatc
atggtcatcacggtgtccctgatcatgctgcgcaacccagtcaccagcaccaacgtcctg
ggcatgatgaccgccatcctgggggtcttcctctataacaagaccaagtacgatgcaaac
cagcaagccaggaagcacctcctccccgtcaccacagcagacctgagcagcaaggagcgt
caccggagcccactggagaagccccacaacggcctcctcttcccccagcacggggactat
cagtacggccgcaacaacatcttaacagaccacttccaatacagccggcagagctaccca
aactcgtacagtttgaaccgctatgatgtgtag

DBGET integrated database retrieval system