KEGG   Homo sapiens (human): 7994Help
Entry
7994              CDS       T01001                                 

Gene name
KAT6A, MOZ, MYST3, RUNXBP2, ZC2HC6A, ZNF220
Definition
K(lysine) acetyltransferase 6A (EC:2.3.1.48)
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     7994 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p11
AA seq 2004 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKS
IERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGKE
SCESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYTNPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKITLSSQSASSSSEEGYLERIDGLDFCRDSNVSLKFNKKTKGLIDGLTKFFTPS
PDGRKARGEVVDYSEQYRIRKRGNRKSSTSDWPTDNQDGWDGKQENEERLFGSQEIMTEK
DMELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLC
EFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLF
LDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGR
FLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLT
GICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVI
VSNSVVSEEEEEEAEEGENEEPQCQERELEISVGKSVSHENKEQDSYSVESEKKPEVMAP
VSSTRLSKQVLPHDSLPANSQPSRRGRWGRKNRKTQERFGDKDSKLLLEETSSAPQEQYG
ECGEKSEATQEQYTESEEQLVASEEQPSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKC
RLTEGSERLPRRYSEGDRAVLRGFSESSEEEEEPESPRSSSPPILTKPTLKRKKPFLHRR
RRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIDEEEEEEDENELF
PREYFRRLSSQDVLRCQSSSKRKSKDEEEDEESDDADDTPILKPVSLLRKRDVKNSPLEP
DTSTPLKKKKGWPKGKSRKPIHWKKRPGRKPGFKLSREIMPVSTQACVIEPIVSIPKAGR
KPKIQESEETVEPKEDMPLPEERKEEEEMQAEAEEAEEGEEEDAASSEVPAASPADSSNS
PETETKEPEVEEEEEKPRVSEEQRQSEEEQQELEEPEPEEEEDAAAETAQNDDHDADDED
DGHLESTKKKELEEQPTREDVKEEPGVQESFLDANMQKSREKIKDKEETELDSEEEQPSH
DTSVVSEQMAGSEDDHEEDSHTKEELIELKEEEEIPHSELDLETVQAVQSLTQEESSEHE
GAYQDCEETLAACQTLQSYTQADEDPQMSMVEDCHASEHNSPISSVQSHPSQSVRSVSSP
NVPALESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTT
ENYENPSSYDSTMGGSICGNSSSQSSCSYGGLSSSSSLTQSSCVVTQQMASMGSSCSMMQ
QSSVQPAANCSIKSPQSCVVERPPSNQQQQPPPPPPQQPQPPPPQPQPAPQPPPPQQQPQ
QQPQPQPQQPPPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESGSTGNISIYERIPGDFG
AGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPL
AGTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSK
SAPLPSAAAHQQQLYGRSPSAVAMQAGPRALAVQRGMNMGVNLMPTPAYNVNSMNMNTLN
AMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTG
PSHHSYMNAAGVPKQSLNGPYMRR
NT seq 6015 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgcaaacccgctttatactgagtggattttggaggccatcaaaaaagtg
aaaaagcagaaacagcgtccttcagaagaaaggatatgcaatgctgtgtcttcatcccat
ggcttggatcgtaaaactgttttagaacaattggagttgagtgttaaagatggaacaatt
ttaaaagtctcaaataaaggactcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaagcctcggaaccatggaaaattggataataaacaaaatgtggattggaat
aaactgataaagcgggcagttgagggcttggcagagtctggtggctcaactttgaaaagc
attgaacgttttttgaaaggtcagaaggatgtgtctgcattattcggaggcagtgctgcc
tctggctttcaccagcagttacgattggctatcaaacgtgccattggccacggcagactc
cttaaagatggacctctttatcggctcaacactaaagcaaccaacgtggatgggaaagag
agttgtgagtctctttcctgtttacctccagtgtcccttcttccacatgaaaaggataag
ccggttgctgaaccaatccccatctgtagtttctgtcttggtacaaaagaacaaaaccga
gaaaagaagccagaggaactcatctcctgtgccgactgtggcaacagtggccatccatcc
tgtttaaagttttcccctgaactaacggttcgagtgaaggccttacggtggcagtgcatc
gagtgtaaaacatgcagctcctgtcgagatcaaggcaaaaatgcggataacatgctcttt
tgtgattcatgtgaccgaggttttcacatggagtgttgtgatccgccactcacccgtatg
ccaaaaggcatgtggatatgtcaaatatgtcgacctaggaaaaaaggacgaaaacttcta
caaaagaaggcagcacagataaaacggcgctatactaatccaataggacgtccaaaaaac
aggttaaagaaacaaaacacggtatcaaaaggtcccttcagcaaagttcgaactggccct
ggaaggggtaggaaacgaaaaatcactctttccagccaatcagcatcatcatcatcagaa
gaaggatatttagagcggatagatggcttggacttctgcagagatagcaatgtctccttg
aagttcaacaagaaaaccaaagggctcattgatggccttaccaaattttttaccccttcc
cctgatgggcggaaagctcggggggaagtggtggactactctgagcaatatcgaatcaga
aagaggggcaacaggaaatcaagcacttcagattggcccacagacaatcaggatggctgg
gatggcaaacaagaaaatgaggagcgactttttgggagccaggaaatcatgactgagaaa
gatatggaattatttcgtgatatccaagaacaagcactgcagaaagttggagtgactggt
ccccctgatccacaagtccgctgtccctctgtcattgagtttgggaagtatgaaattcac
acctggtactcctccccatatcctcaagaatactcaaggctgcccaaattgtatctttgt
gaattttgtctaaaatatatgaaaagtagaactattctgcagcagcacatgaagaaatgt
ggttggttccatcctcctgccaatgagatttacagaaagaataatatttctgtctttgag
gttgatgggaatgtgagtaccatttattgtcaaaacctgtgtcttttggcaaagttgttt
cttgaccacaaaaccctctattacgatgtggagccatttcttttttatgtactaacacag
aatgatgtcaagggctgccaccttgttggctacttttctaaggaaaagcactgccaacag
aagtacaatgtttcctgtataatgattcttcctcaataccagcgtaagggctatggcagg
tttctcatcgatttcagttatttgttatcaaagcgtgaaggccaagcagggtctccagag
aaaccgttatctgatctgggtcgtctttcctacatggcatattggaaaagtgtaatattg
gagtgcctttatcaccaaaatgacaagcagatcagcattaagaagttaagcaagttgact
ggaatctgccctcaagacatcacttccacactccaccacctacgaatgctggacttccgt
agtgaccaatttgtgattatccgccgggaaaaacttatccaggatcacatggcaaagctt
cagctgaatttgcgacctgtagatgtagatccagaatgtttgcgctggactccagtcata
gtgtccaactctgtggtctcagaggaggaagaagaggaggctgaggaaggagaaaacgaa
gagccacagtgccaggaaagagaattagagatcagtgtgggaaagtctgtgtctcatgag
aacaaagaacaagattcttattcagtagaaagtgaaaagaaaccagaagttatggctcca
gtcagttctacacgtttgagcaaacaagtccttcctcatgatagtcttcctgcaaatagc
cagccatctcggaggggccgctgggggaggaagaacagaaaaacccaggaacgttttggt
gataaagattctaaactgctcttggaagagacgtcttcagctcctcaggaacaatatgga
gaatgtggggagaaatcagaagccacccaggaacaatacactgaaagtgaagaacagctg
gtggcttctgaggagcagccaagccaggacgggaaacctgaccttcccaagagaagactc
agtgagggggttgagccctggcgaggacagctcaagaaaagccctgaggctctgaagtgc
agattaacagaaggaagtgagaggctgccccgtcgctacagtgagggtgacagggctgtc
ctcaggggcttcagtgagagcagcgaggaggaggaggagccggaaagccctcggtcaagc
tcgccaccaattctcacaaagcccacgctgaagcgaaagaaaccatttctccaccgaagg
aggagagtccgaaagcgcaaacaccacaatagcagtgtagtcacagaaactatttctgag
accactgaagtgttagatgaaccttttgaagattctgactccgagaggccaatgccaaga
ttagaacccacgtttgagatcgatgaagaagaggaggaagaggatgaaaatgaacttttc
cctagagaatacttccgtcgtttgtcttcgcaggatgtactcaggtgtcagtcctcttct
aagaggaagtctaaagatgaagaagaagatgaagagtcagatgatgctgatgacactcct
atcttaaagccagtatctcttttgcgaaaacgtgatgtgaagaattctcctcttgagcca
gatacatccacacctttgaaaaagaaaaagggatggcccaaaggcaagagccgcaaacca
atccactggaagaaaagacctggtcgaaaaccaggatttaagttgagtcgggaaatcatg
ccagtttctactcaagcatgcgtcattgagcccatcgtttccattcctaaagctggacgt
aaacccaagatccaggagagtgaagaaactgttgagccaaaagaagacatgcccctaccc
gaggagaggaaggaggaggaggagatgcaagcagaggcagaagaggctgaagagggtgag
gaagaggatgcagccagcagtgaagtcccagcagcctctccagcagacagcagcaatagt
cctgagaccgaaaccaaggagcctgaggtggaggaggaagaagagaagccccgtgtctca
gaggagcagaggcagtcagaggaggagcagcaggaattagaggagccagagccagaggag
gaggaagatgcagctgcagagactgcccagaatgacgaccacgacgctgatgatgaggat
gatggccacctggagtccacaaagaaaaaggagctagaggaacagcccacgagggaagat
gtcaaggaggagcctggtgttcaagagtcttttttagatgctaatatgcagaagagtagg
gaaaagataaaggataaagaggaaaccgagctggattccgaagaggagcagccttcccat
gacacgtccgtggtgtcagagcagatggctgggtctgaggacgaccacgaagaagactcc
cacactaaggaagagttaatcgaattaaaagaggaggaagagattcctcatagtgagctg
gatctggaaactgtacaggcagtgcagtctttgactcaagaagaaagcagtgagcatgag
ggcgcctaccaggactgtgaggaaactcttgcggcgtgtcagaccctgcagagttacacc
caggctgacgaggaccctcagatgtccatggttgaagactgtcatgcgtcagaacataat
agccctatctcctccgttcagtctcaccccagccagtcagtccgttcggtcagcagtccc
aacgtgcctgcccttgagagtggctacacccagatcagcccagaacaaggatccctgtcc
gcaccctctatgcagaacatggagaccagccccatgatggatgtgccttccgtatcagac
cactctcagcaggtggtggacagcggcttcagtgacctgggcagcattgagagcaccact
gaaaactatgagaacccaagcagttacgactccacgatgggcggcagcatctgtgggaac
agctcttcccagagcagctgctcctacggtgggctgtcgtcctccagcagcctcacccag
agcagctgtgtggtcactcagcagatggccagcatgggcagcagctgcagcatgatgcag
cagagcagcgtccagcctgctgccaactgcagcatcaagtcacctcagagctgcgtggtg
gagaggcctcccagtaaccagcagcagcagccgccaccaccgcctccacagcagccacag
ccgccgccgccacaaccacaaccagcaccacagcctccaccaccccagcagcagccgcaa
cagcagccgcagcctcagccccagcagcctccacccccaccccctccccagcagcagccc
ccgctgtcacagtgtagtatgaataacagtttcaccccagctcctatgatcatggagata
ccagaatctggaagcactgggaacataagtatctatgagaggattccaggggattttggt
gccggcagctactctcaaccatcagccaccttcagcctagccaagctgcagcagctgacc
aacaccattatggaccctcatgccatgccttatagccattctcctgctgtgacttcctat
gcaaccagtgtttctctgtccaatacaggactggctcagctggctccatctcatccctta
gctgggactcctcaagcacaagccaccatgacgccacccccaaacttggcatccactacc
atgaacctcacatctcctctgcttcagtgcaacatgtctgccaccaacattggcattcct
cacacgcagagattgcaagggcaaatgccagtgaaggggcacatttccatccgctccaag
tctgcgccactgccctctgcggctgctcaccagcagcagctgtatggccgtagcccatcg
gcagttgccatgcaggctggccctcgcgcactggctgttcagcgtggcatgaacatgggg
gttaatctgatgcctactcccgcctataatgtcaattccatgaatatgaacaccttgaat
gccatgaacagctatcgaatgacacagcccatgatgaacagcagttaccatagtaaccct
gcctacatgaaccagacagcacagtatcctatgcagatgcagatgggaatgatggggagc
caggcctatacccagcagcctatgcagcctaaccctcatgggaacatgatgtacacaggc
ccctcccatcacagctacatgaacgctgctggcgtgcccaagcagtcactcaacggacct
tacatgagaagatga

DBGET integrated database retrieval system