KEGG   Homo sapiens (human): 79966Help
Entry
79966             CDS       T01001                                 

Gene name
SCD5, ACOD4, FADS4, HSCD5, SCD2, SCD4
Definition
(RefSeq) stearoyl-CoA desaturase 5
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    79966 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    79966 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    79966 (SCD5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     79966 (SCD5)
Lipid biosynthesis proteins [BR:hsa01004]
 Desaturase
  First
   79966 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 79966
NCBI-ProteinID: NP_001032671
OMIM: 608370
HGNC: 21088
Ensembl: ENSG00000145284
Vega: OTTHUMG00000130293
Pharos: Q86SK9(Tchem)
UniProt: Q86SK9 Q86UC8
Position
4q21.22
AA seq 330 aa AA seqDB search
MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGA
VYSLVLIPKAKPLTLLWAYFCFLLAALGVTAGAHRLWSHRSYRAKLPLRIFLAVANSMAF
QNDIFEWSRDHRAHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLL
ADPVVRIQRKYYKISVVLMCFVVPTLVPWYIWGESLWNSYFLASILRYTISLNISWLVNS
AAHMYGNRPYDKHISPRQNPLVALGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDF
MCWLGLATDRKRATKPMIEARKARTGDSSA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcccggccaccgacgcggggaagatccctttctgcgacgccaaggaagaaatc
cgtgccgggctcgaaagctctgagggcggcggcggcccggagaggccaggcgcgcgcggg
cagcggcagaacatcgtctggaggaatgtcgtcctgatgagcttgctccacttgggggcc
gtgtactccctggtgctcatccccaaagccaagccactcactctgctctgggcctacttc
tgcttcctcctggccgctctgggtgtgacagctggtgcccatcgcttgtggagccacagg
tcctaccgggccaagctgcctctgaggatatttctggctgtcgccaactccatggctttc
cagaatgacatcttcgagtggtccagggaccaccgagcccaccacaagtactcagagacg
gatgctgacccccacaatgcccgccggggcttcttcttctcccatattgggtggctgttt
gttcgcaagcatcgagatgttattgagaaggggagaaagcttgacgtcactgacctgctt
gctgatcctgtggtccggatccagagaaagtactataagatctccgtggtgctcatgtgc
tttgtggtccccacgctggtgccctggtacatctggggagagagtctgtggaattcctac
ttcttggcctctattctccgctataccatctcactcaacatcagctggctggtcaacagc
gccgcccacatgtatggaaaccggccctatgacaagcacatcagccctcggcagaaccca
ctcgtcgctctgggtgccattggtgaaggcttccataattaccatcacacctttcccttt
gactactctgcgagtgaatttggcttaaattttaacccaaccacctggttcattgatttc
atgtgctggctggggctggccactgaccgcaaacgggcaaccaagccgatgatcgaggcc
cggaaggccaggactggagacagcagtgcttga

DBGET integrated database retrieval system