KEGG   Homo sapiens (human): 79966Help
Entry
79966             CDS       T01001                                 

Gene name
SCD5, ACOD4, FADS4, HSCD5, SCD2, SCD4
Definition
stearoyl-CoA desaturase 5 (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
hsa  Homo sapiens (human)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:hsa01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:hsa01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21.22
AA seq 330 aa AA seqDB search
MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGA
VYSLVLIPKAKPLTLLWAYFCFLLAALGVTAGAHRLWSHRSYRAKLPLRIFLAVANSMAF
QNDIFEWSRDHRAHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLL
ADPVVRIQRKYYKISVVLMCFVVPTLVPWYIWGESLWNSYFLASILRYTISLNISWLVNS
AAHMYGNRPYDKHISPRQNPLVALGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDF
MCWLGLATDRKRATKPMIEARKARTGDSSA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcccggccaccgacgcggggaagatccctttctgcgacgccaaggaagaaatc
cgtgccgggctcgaaagctctgagggcggcggcggcccggagaggccaggcgcgcgcggg
cagcggcagaacatcgtctggaggaatgtcgtcctgatgagcttgctccacttgggggcc
gtgtactccctggtgctcatccccaaagccaagccactcactctgctctgggcctacttc
tgcttcctcctggccgctctgggtgtgacagctggtgcccatcgcttgtggagccacagg
tcctaccgggccaagctgcctctgaggatatttctggctgtcgccaactccatggctttc
cagaatgacatcttcgagtggtccagggaccaccgagcccaccacaagtactcagagacg
gatgctgacccccacaatgcccgccggggcttcttcttctcccatattgggtggctgttt
gttcgcaagcatcgagatgttattgagaaggggagaaagcttgacgtcactgacctgctt
gctgatcctgtggtccggatccagagaaagtactataagatctccgtggtgctcatgtgc
tttgtggtccccacgctggtgccctggtacatctggggagagagtctgtggaattcctac
ttcttggcctctattctccgctataccatctcactcaacatcagctggctggtcaacagc
gccgcccacatgtatggaaaccggccctatgacaagcacatcagccctcggcagaaccca
ctcgtcgctctgggtgccattggtgaaggcttccataattaccatcacacctttcccttt
gactactctgcgagtgaatttggcttaaattttaacccaaccacctggttcattgatttc
atgtgctggctggggctggccactgaccgcaaacgggcaaccaagccgatgatcgaggcc
cggaaggccaggactggagacagcagtgcttga

DBGET integrated database retrieval system