KEGG   Homo sapiens (human): 79968Help
Entry
79968             CDS       T01001                                 

Gene name
WDR76, CDW14
Definition
(RefSeq) WD repeat domain 76
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 79968
NCBI-ProteinID: NP_079184
HGNC: 25773
Ensembl: ENSG00000092470
Vega: OTTHUMG00000060143
Pharos: Q9H967(Tbio)
UniProt: Q9H967
Position
15q15.3
AA seq 626 aa AA seqDB search
MSRSGAAAEKADSRQRPQMKVNEYKENQNIAYVSLRPAQTTVLIKTAKVYLAPFSLSNYQ
LDQLMCPKSLSEKNSNNEVACKKTKIKKTCRRIIPPKMKNTSSKAESTLQNSSSAVHTES
NKLQPKRTADAMNLSVDVESSQDGDSDEDTTPSLDFSGLSPYERKRLKNISENADFFASL
QLSESAARLREMIEKRQPPKSKRKKPKRENGIGCRRSMRLLKVDPSGVSLPAAPTPPTLV
ADETPLLPPGPLEMTSENQEDNNERFKGFLHTWAGMSKPSSKNTEKGLSSIKSYKANLNG
MVISEDTVYKVTTGPIFSMALHPSETRTLVAVGAKFGQVGLCDLTQQPKEDGVYVFHPHS
QPVSCLYFSPANPAHILSLSYDGTLRCGDFSRAIFEEVYRNERSSFSSFDFLAEDASTLI
VGHWDGNMSLVDRRTPGTSYEKLTSSSMGKIRTVHVHPVHRQYFITAGLRDTHIYDARRL
NSRRSQPLISLTEHTKSIASAYFSPLTGNRVVTTCADCNLRIFDSSCISSKIPLLTTIRH
NTFTGRWLTRFQAMWDPKQEDCVIVGSMAHPRRVEIFHETGKRVHSFGGEYLVSVCSINA
MHPTRYILAGGNSSGKIHVFMNEKSC
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtccaggtcgggcgcggcggctgagaaggcggactccagacagcgaccccagatgaag
gtaaatgaatataaagaaaatcaaaacatcgcttatgtgtctctgagaccagcacagact
acagttttaataaaaacagctaaggtctatcttgcccccttttcactcagtaattaccag
ctagaccagcttatgtgccccaaatccctatcagaaaagaattctaacaatgaagtggcg
tgtaagaagactaaaataaagaaaacttgcagaaggattatacctccaaagatgaaaaac
acatcttccaaggcagaatccacgctgcaaaattcatcctcagctgttcatactgaaagt
aacaagctacaacccaagagaacggcagatgcgatgaatctcagtgttgatgtggaaagt
agtcaggatggagacagtgatgaagataccacaccatccctggatttttcgggattgtca
ccctacgaaaggaagagactgaagaacatatcagaaaacgcagacttttttgcttctctt
cagttgtctgagtctgctgcaagactccgtgaaatgatagagaagagacagcctcctaaa
tccaaaagaaagaagcctaagagagaaaatgggattggatgtagaaggtcaatgcgatta
ctaaaagttgatccttcgggagtttcattaccagcagctccaacaccgccgacattagta
gcagatgaaactcctttgttacctcctgggcctttagaaatgacttctgaaaatcaagaa
gacaacaatgaacgatttaaaggatttctgcacacatgggcaggaatgagcaagccaagt
agtaagaacactgagaagggattatctagcattaaaagctacaaagccaatttaaatggc
atggtcattagtgaagataccgtttacaaagttaccacaggcccaatattctctatggct
ctccatccatcagaaactagaactttggtagcagttggggccaaatttgggcaagttgga
ctttgtgatttgacccagcaacctaaagaagatggagtttatgtttttcatccccatagt
cagccagttagctgtctttacttctcacccgccaatccggcccacatactgtcactgagc
tatgatggcacgttacgctgtggggatttttccagggctatttttgaagaggtgtataga
aatgaaagaagtagcttttcctccttcgacttcttggcagaagatgcctccactttaata
gtaggacactgggatggaaatatgtcactggtggatagacggacacctggaacttcttat
gagaaacttaccagttcttctatgggaaaaataagaactgttcatgtccacccagtgcat
agacagtattttatcactgccggattgagggatactcatatttatgatgcaaggcgattg
aattccaggagaagtcagcctttgatttctttgactgaacatacaaagagcattgcttcc
gcctatttttcacctcttactggtaacagagtggtgaccacatgtgctgattgtaatctg
agaatttttgacagcagctgtatatcttctaagattccgctcctcaccaccatcaggcac
aacactttcactgggcgatggctgaccaggttccaagccatgtgggatcctaaacaagaa
gactgtgtcatagttggcagcatggcccatccacgacgggtagaaatcttccatgagaca
ggaaagagggtgcattcgtttggtggagaataccttgtctctgtgtgttccatcaatgcc
atgcacccaactcggtatattttggctggaggtaattccagcgggaagatacatgttttt
atgaatgaaaaaagctgctga

DBGET integrated database retrieval system