KEGG   Homo sapiens (human): 79998Help
Entry
79998             CDS       T01001                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p13.3
AA seq 530 aa AA seqDB search
MASAGSTARRAGSGSWHSERGEGRGARPQPTPSGSMQQANKVSLKATWTDAESKQPSQPL
PDLADHLSAQATALARPRRPASLTPPRADPSPSKESDQTAIDQTAIGSYYQLFAAAVGNV
EWLRFCLNQSLREIPTDDKGFTAIHFAAQWGKLACLQVLVEEYKFPVDLLTNNSQTPLHL
VIHRDNTTVALPCIYYLLEKGADLNAQTCNGSTPLHLAARDGLLDCVKVLVQSGANVHAQ
DAMGYKPIDFCKIWNHRACARFLKDAMWKKDKKDFAREMTKMKMFKSQLTLMEHNYLIEY
QKEHKILREAAIRKWLHGKLHPGHSLVSNTKQARATALSKTPEQRESQRSRSFHPSVDAR
LQCIPQPTEMPKPIYRKPTVKRPTMWNVSNNPARPPTTQISHSQGIRLGVHPDPTPEHDF
SSFLEVRPDGHGGARLHTVDGHWVAPVPRLPFEVLLRMLYPRVWPYRMKVPQGFYPISMR
EVPRKRHLGDNTFWTDTLAMNLRDTFDEAFLAAVRSHQGLPTLPSPQTNP
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgcgggcagcaccgctcggcgggcgggctccggaagctggcactcagaaagg
ggagaagggagaggtgctcggccgcagccaactccaagtggctccatgcagcaggcgaac
aaagtctccttgaaggccacctggactgacgcggagtccaagcagcccagccagcccctg
cccgacctcgcagaccacctcagtgcgcaggcgactgccctcgccaggccgcgccgccct
gcctcgctcaccccgccccgcgctgaccccagccccagcaaggagtccgaccagacggca
atcgaccagacggcgatcgggagctactaccagctgttcgcagcggctgtgggcaacgtg
gaatggctgcgattctgtctgaaccagagcctcagggaaatccccaccgacgacaagggc
ttcactgccatccacttcgccgcccaatggggcaagcttgcatgcctgcaggtcctggta
gaggagtacaagtttcccgtggacctgctgaccaacaatagccagacacccctgcacctc
gtcatccacagggacaacaccaccgtggccctcccctgcatctactacctgctggagaaa
ggcgcagacctcaatgctcagacatgcaacggctccacgcccctgcacctggcagcccgt
gacggcttgctggactgtgtgaaggtcctggtgcagagtggcgccaacgtccatgcccaa
gatgccatgggctacaaacccattgacttctgcaaaatatggaaccaccgtgcctgtgcc
cggttcttgaaggatgccatgtggaaaaaggacaagaaggactttgcccgtgagatgacg
aaaatgaagatgttcaagagccagctgaccctcatggagcacaactacctgattgagtat
caaaaagagcacaaaattctcagagaagctgctatcagaaagtggctccacggcaagctg
cacccaggccactctctggtctccaataccaagcaagcccgggccaccgccctctccaag
accccagagcaacgggaatcgcagcgttccaggagcttccacccctctgtggatgcacgc
ctgcaatgcattccacagcccacggagatgcccaagcccatctacaggaagcccacggtc
aagcggcccacaatgtggaatgttagcaacaaccccgccagaccccccaccacccagatc
agccactcgcagggcatccgcctgggcgtgcatccagaccccactccggagcacgacttc
agcagcttcctggaggtgaggcctgatgggcacggcggtgcgcggctgcacacagtggac
ggccactgggtggcgcccgtgccgcggctgccttttgaggtgctgctgcgcatgctgtac
ccacgtgtatggccatacagaatgaaggtgccccagggcttttaccccatcagcatgagg
gaagtgcccaggaagcggcacctgggtgacaacaccttctggaccgacactctggccatg
aacctgcgtgacacattcgatgaagccttcctggcagctgtgcgatctcatcaaggactc
cccaccctgccctccccacaaaccaacccataa

DBGET integrated database retrieval system