KEGG   Homo sapiens (human): 800Help
Entry
800               CDS       T01001                                 

Gene name
CALD1, CDM, H-CAD, HCAD, L-CAD, LCAD, NAG22
Definition
caldesmon 1
Orthology
K12327  
caldesmon
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    800 (CALD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q33
AA seq 538 aa AA seqDB search
MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLG
QVTDQVEVNAQNSVPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKE
FDPTITDASLSLPSRRMQNDTAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDA
EENKKEDKEKEEEEEEKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQN
GEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLK
QKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEA
AEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKI
DSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKET
AGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggatgattttgagcgtcgcagagaacttagaaggcaaaagagggaggagatgcgactc
gaagcagaaagaatcgcctaccagaggaatgacgatgatgaagaggaggcagcccgggaa
cggcgccgccgagcccgacaggaacggctgcggcagaagcaggaggaagaatccttggga
caggtgaccgaccaggtggaggtgaatgcccagaacagtgtgcctgacgaggaggccaag
acaaccaccacaaacactcaagtggaaggggatgatgaggccgcattcctggagcgcctg
gctcggcgtgaggaaagacgccaaaaacgccttcaggaggctctggagcggcagaaggag
ttcgacccaacaataacagatgcaagtctgtcgctcccaagcagaagaatgcaaaatgac
acagcagaaaatgaaactaccgagaaggaagaaaaaagtgaaagtcgccaagaaagatac
gagatagaggaaacagaaacagtcaccaagtcctaccagaagaatgattggagggatgct
gaagaaaacaagaaagaagacaaggaaaaggaggaggaggaagaggagaagccaaagcga
gggagcattggagaaaatcagatcaaagatgaaaagattaaaaaggacaaagaacccaaa
gaagaagttaagagcttcatggatcgaaagaagggatttacagaagttaagtcgcagaat
ggagaattcatgacccacaaacttaaacatactgagaatactttcagccgccctggaggg
agggccagcgtggacaccaaggaggctgagggcgccccccaggtggaagccggcaaaagg
ctggaggagcttcgtcgtcgtcgcggggagaccgagagcgaagagttcgagaagctcaaa
cagaagcagcaggaggcggctttggagctggaggaactcaagaaaaagagggaggagaga
aggaaggtcctggaggaggaagagcagaggaggaagcaggaggaagccgatcgaaaactc
agagaggaggaagagaagaggaggctaaaggaagagattgaaaggcgaagagcagaagct
gctgagaaacgccagaagatgccagaagatggcttgtcagatgacaagaaaccattcaag
tgtttcactcctaaaggttcatctctcaagatagaagagcgagcagaatttttgaataag
tctgtgcagaaaagcagtggtgtcaaatcgacccatcaagcagcaatagtctccaagatt
gacagcagactggagcagtataccagtgcaattgagggaacaaaaagcgcaaaacctaca
aagccggcagcctcggatcttcctgttcctgctgaaggtgtacgcaacatcaagagtatg
tgggagaaagggaatgtgttttcatcccccactgcagcaggcacaccaaataaggaaact
gctggcttgaaggtaggggtttctagccgcatcaatgaatggctaactaaaaccccagat
ggaaacaagtcacctgctcccaaaccttctgacttgagaccaggagacgtatccagcaag
cggaacctctgggaaaagcaatctgtggataaggtcacttcccccactaaggtttga

DBGET integrated database retrieval system