KEGG   Homo sapiens (human): 8001Help
Entry
8001              CDS       T01001                                 

Gene name
GLRA3
Definition
(RefSeq) glycine receptor alpha 3
  KO
K05195  
glycine receptor alpha-3
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Glycine: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8001 (GLRA3)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Glycine
   8001 (GLRA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q34.1
AA seq 464 aa AA seqDB search
MAHVRHFRTLVSGFYFWEAALLLSLVATKETDSARSRSAPMSPSDFLDKLMGRTSGYDAR
IRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDP
SMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPM
DVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTGKF
TCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQS
SGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEA
FALEKFYRFSDMDDEVRESRFSFTAYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKV
FIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRHEDIHQQQD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgtgagacactttcggacattagtttcgggattttacttctgggaagcagca
ctgttactcagtttggttgccacaaaggaaacagacagtgcaagatctcgaagtgctcca
atgtcaccttctgattttctggataaattaatgggcaggacatcaggatatgatgcaaga
atcagacccaattttaaaggccctccagttaatgtcacatgcaacatattcatcaacagc
tttggctctatcgcagagacgaccatggattacagagtgaatatctttcttcgtcagaaa
tggaatgatccccgcctcgcgtacagtgaatatcctgacgactctttagacctcgacccc
tccatgttggactccatttggaaacctgatttgttctttgccaatgaaaagggtgccaac
tttcatgaagtcactacagacaacaaattgctaagaattttcaaaaatggaaatgttctt
tattcaataagattaacattaacactttcctgtccaatggatctcaagaattttcccatg
gatgtacaaacatgtataatgcaactggaaagctttgggtacacaatgaatgatctcatt
tttgaatggcaagatgaggcacccgtacaagtggcagaaggactcactttgccccagttt
ctgttgaaagaagaaaaagatttacgatactgcactaaacattacaatacaggaaagttt
acgtgtatagaagtgcgattccatctggagcgacaaatgggatactatctgatccagatg
tacattcccagtctcctgattgttattctatcctgggtttcattctggatcaacatggat
gcagcaccggccagggtagctctggggataaccactgtgctaacgatgactacacagagt
tcaggatcacgagcttccttgccaaaagtttcatatgtcaaagctattgatatttggatg
gcagtatgcctcctttttgtgttttcagcacttctggagtatgcagctgtaaattttgta
tcaagacaacacaaagaacttctgagatttcgacgaaagagaaagaataagacagaagct
tttgcactggagaagttttaccgtttctcagatatggatgatgaggtaagggaaagccga
ttcagcttcacagcctatggaatgggaccatgtctacaagcaaaggatggcatgactcca
aagggccccaaccaccctgtccaggtaatgccaaaaagtcctgatgaaatgaggaaggtc
tttatcgaccgggccaagaagattgataccatctcccgagcctgcttcccattagctttt
ttgatttttaatattttctactgggttatctataaaattcttaggcatgaggatattcat
cagcagcaagattaa

DBGET integrated database retrieval system