KEGG   Homo sapiens (human): 80010Help
Entry
80010             CDS       T01001                                 

Gene name
RMI1, BLAP75, C9orf76, FAAP75
Definition
(RefSeq) RecQ mediated genome instability 1
  KO
K10990  
RecQ-mediated genome instability protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Fanconi anemia pathway
Module
Bloom's syndrome complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    80010 (RMI1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     80010 (RMI1)
   FA (Fanconi anemia) pathway
     80010 (RMI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9H9A7(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
9q21.32
AA seq 625 aa AA seqDB search
MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTD
LRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA
QVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVL
LLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDLVVSVIPNNSNENIPRVTDVLDPAL
GPSDEELLASLDENDELTANNDTSSERCFTTGSSSNTIPTRQSSFEPEFVISPRPKEEPS
NLSIHVMDGELDDFSLEEALLLEETVQKEQMETKELQPLTFNRNADRSIERFSHNPNTTN
NFSLTCKNGNNNWSEKNVSEQMTNEDKSFGCPSVRDQNRSIFSVHCNVPLAHDFTNKEKN
LETDNKIKQTSSSDSHSLNNKILNREVVNYVQKRNSQISNENDCNLQSCSLRSSENSINL
SIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAY
LDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSL
SKAMVLALQDVNMEHLENLKKRLNK
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgactagtattgcattaagagctgaaacttggcttttagctgcatggcatgtt
aaagtacctccgatgtggctggaagcttgtattaactggattcaagaagaaaataataat
gttaacttgagtcaggcccaaatgaataaacaagtgtttgagcagtggctccttactgat
ctgagggatttggagcatcctcttttacccgatggcattttagaaattccaaaaggagaa
ttaaatggattttatgctctgcagattaattccttggttgatgtaagtcagcctgcatac
tcccagatacagaagttgagaggaaagaatacaacaaatgatctagttacagctgaagca
caagtaaccccaaaaccttgggaagcaaagccttcacgaatgttgatgctgcagctaact
gatggaatcgtacaaatacagggaatggaatatcagcctattccaattcttcatagtgat
cttcctccaggtacaaaaattttgatttatggaaatatatctttccgtcttggtgttctc
ttattgaaaccagaaaacgtgaaagtgttaggaggtgaagtagatgctcttttagaagaa
tatgcccaagaaaaagtacttgcaagattaataggggaacctgatcttgtagtttcagtc
ataccaaacaattctaacgaaaacattcccagagttacagatgttctagatcctgcatta
ggtccttctgatgaagaactcttggcaagtcttgatgaaaatgatgagcttacagcaaat
aatgacacttcctcagaacgatgtttcaccacaggtagttcctcaaataccattcccaca
agacagtcaagttttgagccagaatttgttatttctccaagaccaaaagaggaaccatca
aacctatctatacatgtaatggatggagaattagatgacttttcactggaggaggccttg
cttttagaagaaactgtccagaaagaacagatggaaactaaggaattgcaaccattgact
tttaacagaaatgccgatcgaagtatagagagattttcacataatcctaatactacgaat
aacttttctttgacttgcaaaaatggaaacaataattggagtgaaaaaaatgtatctgaa
caaatgactaatgaagacaaatcatttggttgtccatctgttagagaccaaaacaggagt
attttttcagttcattgtaatgtacccttagcccatgattttacaaataaagaaaagaac
ttagagacagataataaaataaaacaaaccagcagttcagatagccattccttaaataat
aaaatattaaatagagaggtggtcaactatgtacagaaaaggaattcacaaatttctaat
gaaaatgattgtaatttacagagttgttctttaagatcatcagagaatagcattaatctt
tctattgccatggatttgtattctccaccctttgtctatttgtctgttctaatggccagc
aaaccaaaggaagttacaacagtgaaagtgaaagcatttattgtaaccttaactggaaat
ctctcaagttctggtggtatttggagtataactgcaaaggtgtctgatggtactgcatat
ctagatgtagactttgtggatgaaatacttactagcttgatagggttctcagtaccagaa
atgaaacagtcaaaaaaggatcctcttcaataccaaaagttcctggaagggttgcagaaa
tgtcaaagagatctaatagatttgtgctgtctaatgactatttcatttaatccttccttg
tctaaagcaatggtactggcattacaagatgttaatatggaacaccttgagaatctaaag
aagcggttaaataaataa

DBGET integrated database retrieval system