KEGG   Homo sapiens (human): 80034Help
Entry
80034             CDS       T01001                                 

Gene name
CSRNP3, FAM130A2, PPP1R73, TAIP-2, TAIP2
Definition
(RefSeq) cysteine and serine rich nuclear protein 3
  KO
K17494  
cysteine/serine-rich nuclear protein
Organism
hsa  Homo sapiens (human)
Brite
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     80034 (CSRNP3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     80034 (CSRNP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q24.3
AA seq 585 aa AA seqDB search
MSGILKRKFEEVDGSSPCSSVRESDDEVSSSESADSGDSVNPSTSSHFTPSSILKREKRL
RTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREM
LREHLREEKLNSLKLKMTKNGTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTK
KRRALLRASGVKKIDVEEKHELRAIRLSREDCGCDCRVFCDPDTCTCSLAGIKCQVDRMS
FPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQIPTLNGCHSEISAHSS
SMGPVAHSVEYSIADSFEIETEPQAAVLHLQSAEELDCQGEEEEEEEDGSSFCSGVTDSS
TQSLAPSESDEEEEEEEEEEEEEDDDDDKGDGFVEGLGTHAEVVPLPSVLCYSDGTAVHE
SHAKNASFYANSSTLYYQIDSHIPGTPNQISENYSERDTVKNGTLSLVPYTMTPEQFVDY
ARQAEEAYGASHYPAANPSVIVCCSSSENDSGVPCNSLYPEHRSNHPQVEFHSYLKGPSQ
EGFVSALNGDSHISEHPAENSLSLAEKSILHEECIKSPVVETVPV
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaattttaaagaggaagtttgaagaagttgacggctcctcaccctgctcctct
gtgagggaatcagatgatgaagtttccagcagtgaaagtgctgacagtggggacagtgtc
aatccatccacttctagtcattttaccccttcctccattctcaaaagggagaaacgactg
aggacaaagaatgtacattttagttgtgtcaccgtgtactacttcaccaggaggcaaggc
ttcacaagtgtgcccagtcaagggggaagcaccctggggatgtccagccgccataacagc
gtgcgccagtacactcttggcgagtttgcaagggagcaggagaggctccaccgggagatg
ttgagagaacaccttagggaggaaaagctgaactccttaaaactaaagatgactaagaat
ggcacagtagaatcagaagaagccagcactcttacactggatgacatttctgatgatgac
attgacctggacaacacagaggtagatgagtacttcttcctacaacctttgccaacaaaa
aaacgaagagctctgctgcgtgcctctggagtgaaaaagattgacgtggaagaaaagcac
gaactccgagccatccgcctctcacgagaggactgtggctgtgactgccgagtgttctgt
gatccagacacgtgcacctgcagcctggctggcattaagtgccaggtggatcgtatgtct
ttcccatgcggctgcactaaagaaggatgtagtaacacagcaggtagaattgaatttaat
cctatccgtgttcggactcactttttgcacacaataatgaaacttgaactggagaaaaac
cgagagcagcaaatccccacgctgaatggctgccacagtgagataagtgctcacagtagt
tctatgggccctgtcgctcactccgtagaatattcaatcgcagacagttttgagattgaa
actgagccccaggctgcagtgctgcacctgcagtcggctgaagaattagattgccaagga
gaggaggaggaagaagaggaggatgggagcagcttttgcagcggagtcacagattctagc
acgcaaagcttggcacctagtgagtcagacgaggaggaggaggaagaagaagaggaagag
gaggaggaggatgacgatgatgacaaaggagatggcttcgtggaaggtttgggcacccat
gccgaagttgtccctcttccttcagttctttgttattctgatggcaccgccgttcacgaa
agccatgcaaagaatgcttctttttatgccaactcttcaactctgtattaccaaatagat
agccacattccaggaactccaaatcagatctctgagaactattctgaaagagacactgtc
aaaaatggtaccctttcgctggtgccttacaccatgaccccggagcaattcgttgactat
gcccgacaagcagaagaggcctatggtgcctcccactacccagctgccaacccctctgta
atcgtttgctgctcctcttccgaaaatgatagcggtgtgccctgcaatagtttatatcct
gaacacaggtccaatcaccctcaagtggaatttcactcatacttgaaaggcccctcccaa
gaagggtttgtctctgcattgaatggtgacagtcacatttcagagcatcctgctgaaaat
tctttgagccttgcagaaaagagcatattgcatgaagagtgcatcaaatcacccgtggtt
gagacagtccctgtttag

DBGET integrated database retrieval system