KEGG   Homo sapiens (human): 80036Help
Entry
80036             CDS       T01001                                 

Gene name
TRPM3, GON-2, LTRPC3, MLSN2
Definition
(RefSeq) transient receptor potential cation channel subfamily M member 3
  KO
K04978  
transient receptor potential cation channel subfamily M member 3
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   80036 (TRPM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q21.12
AA seq 1707 aa AA seqDB search
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKA
QKSWIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDI
QSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELP
KLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHAS
KSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFILADNGTT
GKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVV
VCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMK
KKELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFIYGQQ
WPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVR
DVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGM
EDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGE
EAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAM
KLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGIL
LPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGES
SRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPS
TQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILRL
QDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLM
SFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLP
PCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHE
RPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHDFEEQCIE
EYFREKDDRFNSSNDERIRVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLI
GRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPAGE
ETMSPTSPTLMPRMRSHSFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAKEPKAP
AAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDIDPLDNSVNILGLGEPSFSTPVPSTAP
SSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEPPMYHTIERSK
SSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQ
AIADRAAFPGGLGDKVEDLTCCHPEREAELSHPSSDSEENEAKGRRATIAISSQEGDNSE
RTLSNNITVPKIERANSYSAEEPSAPYAHTRKSFSISDKLDRQRNTASLRNPFQRSKSSK
PEGRGDSLSMRRLSRTSAFQSFESKHN
NT seq 5124 nt NT seq  +upstreamnt  +downstreamnt
atgccagagccgtgggggaccgtttattttctaggcattgctcaggttttcagtttcttg
ttttcctggtggaatttggaaggggtcatgaatcaggctgatgctcctcgacccctaaac
tggaccatccggaagctgtgccacgcagcctttcttccatctgtcagacttctgaaggct
cagaaatcctggatagaaagagcattttataaaagagaatgtgtccacatcatacccagc
accaaagacccccataggtgttgctgtgggcgtctgataggccagcatgttggcctcacc
cccagtatctccgtgcttcagaatgagaaaaatgaaagtcgcctctcccgaaatgacatc
cagtctgaaaagtggtccatcagcaaacacactcaactcagccctacggatgcttttggg
accattgagttccaaggaggtggccattccaacaaagccatgtatgtgcgagtatctttt
gatacaaaacctgatctcctcttacacctgatgaccaaggaatggcagttggagcttccc
aagcttctcatctctgtccatgggggcctgcagaactttgaactccagccaaaactcaag
caagtctttgggaaagggctcatcaaagcagcaatgacaactggagcgtggatattcact
ggaggggttaacacaggtgttattcgtcatgttggcgatgccttgaaggatcatgcctct
aagtctcgaggaaagatatgcaccataggtattgccccctggggaattgtggaaaaccag
gaggacctcattggaagagatgttgtccggccataccagaccatgtccaatcccatgagc
aagctcactgttctcaacagcatgcattcccacttcattctggctgacaacgggaccact
ggaaaatatggagcagaggtgaaacttcgaagacaactggaaaagcatatttcactccag
aagataaacacaagaatcggtcaaggtgttcctgtggtggcactcatagtggaaggagga
cccaatgtgatctcgattgttttggagtaccttcgagacacccctcccgtgccagtggtt
gtctgtgatgggagtggacgggcatcggacatcctggcctttgggcataaatactcagaa
gaaggcggactgataaatgaatctttgagggaccagctgttggtgactatacagaagact
ttcacatacactcgaacccaagctcagcatctgttcatcatcctcatggagtgcatgaag
aagaaggaattgattacggtatttcggatgggatcagaaggacaccaggacattgatttg
gctatcctgacagctttactcaaaggagccaatgcctcggccccagaccaactgagctta
gctttagcctggaacagagtcgacatcgctcgcagccagatctttatttacgggcaacag
tggccggtgggatctctggagcaagccatgttggatgccttagttctggacagagtggat
tttgtgaaattactcatagagaatggagtaagcatgcaccgttttctcaccatctccaga
ctagaggaattgtacaatacgagacatgggccctcaaatacattgtaccacttggtcagg
gatgtcaaaaaggggaacctgcccccagactacagaatcagcctgattgacatcggcctg
gtgatcgagtacctgatgggcggggcttatcgctgcaactacacgcgcaagcgcttccgg
accctctaccacaacctcttcggccccaagaggcccaaagccttgaaactgctgggaatg
gaggatgatattcccttgaggcgaggaagaaagacaaccaagaaacgtgaagaagaggtg
gacattgacttggatgatcctgagatcaaccacttccccttccctttccatgagctcatg
gtgtgggctgttctcatgaagcggcagaagatggccctgttcttctggcagcacggtgag
gaggccatggccaaggccctggtggcctgcaagctctgcaaagccatggctcatgaggcc
tctgagaacgacatggttgacgacatttcccaggagctgaatcacaattccagagacttt
ggccagctggctgtggagctcctggaccagtcctacaagcaggacgaacagctggccatg
aaactgctgacgtatgagctgaagaactggagcaacgccacgtgcctgcagcttgccgtg
gctgccaaacaccgcgacttcatcgcgcacacgtgcagccagatgctgctcaccgacatg
tggatgggccggctccgcatgcgcaagaactcaggcctcaaggtaattctgggaattcta
cttcctccttcaattctcagcttggagttcaagaacaaagacgacatgccctatatgtct
caggcccaggaaatccacctccaagagaaggaggcagaagaaccagagaagcccacaaag
gaaaaagaggaagaggacatggagctcacagcaatgttgggacgaaacaacggggagtcc
tccaggaagaaggatgaagaggaagttcagagcaagcaccggttaatccccctcggcaga
aaaatctatgaattctacaatgcacccatcgtgaagttctggttctacacactggcgtat
atcggatacctgatgctcttcaactatatcgtgttagtgaagatggaacgctggccgtcc
acccaggaatggatcgtaatctcctatattttcaccctgggaatagaaaagatgagagag
attctgatgtcagagccagggaagttgctacagaaagtgaaggtatggctgcaggagtac
tggaatgtcacggacctcatcgccatccttctgttttctgtcggaatgatccttcgtctc
caagaccagcccttcaggagtgacgggagggtcatctactgcgtgaacatcatttactgg
tatatccgtctcctagacatcttcggcgtgaacaagtatttgggcccgtatgtaatgatg
attggaaaaatgatgatagacatgatgtactttgtcatcattatgctggtggttctgatg
agctttggggtcgccaggcaagccatcctttttcccaatgaggagccatcatggaaactg
gccaagaacatcttctacatgccctattggatgatttatggggaagtgtttgcggaccag
atagaccctccctgtggacagaatgagacccgagaggatggtaaaataatccagctgcct
ccctgcaagacaggagcttggatcgtgccggccatcatggcctgctacctcttagtggca
aacatcttgctggtcaacctcctcattgctgtctttaacaatacattttttgaagtaaaa
tcgatatccaaccaagtctggaagtttcagaggtatcagctcatcatgactttccatgaa
aggccagttctgcccccaccactgatcatcttcagccacatgaccatgatattccagcac
ctgtgctgccgatggaggaaacacgagagcgacccggatgaaagggactacggcctgaaa
ctcttcataaccgatgatgagctcaagaaagtacatgactttgaagagcaatgcatagaa
gaatacttcagagaaaaggatgatcggttcaactcatctaatgatgagaggatacgggtg
acttcagaaagggtggagaacatgtctatgcggctggaggaagtcaacgagagagagcac
tccatgaaggcttcactccagaccgtggacatccggctggcgcagctggaagaccttatc
gggcgcatggccacggccctggagcgcctgacaggtctggagcgggccgagtccaacaaa
atccgctcgaggacctcgtcagactgcacggacgccgcctacattgtccgtcagagcagc
ttcaacagccaggaagggaacaccttcaagctccaagagagtatagaccctgcaggtgag
gagaccatgtccccaacttctccaaccttaatgccccgtatgcgaagccattctttctat
tcggtcaatatgaaagacaaaggtggtatagaaaagttggaaagtatttttaaagaaagg
tccctgagcctacaccgggctactagttcccactctgtagcaaaagaacccaaagctcct
gcagcccctgccaacaccttggccattgttcctgattccagaagaccatcatcgtgtata
gacatctatgtctctgctatggatgagctccactgtgatatagaccctctggacaattcc
gtgaacatccttgggctgggcgagccaagcttttcaactccagtaccttccacagcccct
tcaagtagtgcctatgcaacacttgcacccacagacagacctccaagccggagcattgat
tttgaggacatcacctccatggacactagatctttttcttcagactacacccacctccca
gaatgccaaaacccctgggactcagagcctccgatgtaccacaccattgagcgttccaaa
agtagccgctacctagccaccacaccctttcttctagaagaggctcccattgtgaaatct
catagctttatgttttccccctcaaggagctattatgccaactttggggtgcctgtaaaa
acagcagaatacacaagtattacagactgtattgacacaaggtgtgtcaatgcccctcaa
gcaattgcggacagagctgccttccctggaggtcttggagacaaagtggaggacttaact
tgctgccatccagagcgagaagcagaactgagtcaccccagctctgacagtgaggagaat
gaggccaaaggccgcagagccaccattgcaatatcctcccaggagggtgataactcagag
agaaccctgtccaacaacatcactgttcccaagatagagcgcgccaacagctactcggca
gaggagccaagtgcgccatatgcacacaccaggaagagcttctccatcagtgacaaactc
gacaggcagcggaacacagcaagcctgcgaaatcccttccagagaagcaagtcctccaag
ccggagggccgaggggacagcctgtccatgaggagactgtccagaacatcggctttccaa
agctttgaaagcaagcacaactaa

DBGET integrated database retrieval system