KEGG   Homo sapiens (human): 80045Help
Entry
80045             CDS       T01001                                 

Gene name
GPR157
Definition
(RefSeq) G protein-coupled receptor 157
  KO
K08467  G protein-coupled receptor 157
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Other
   Putative / unclassified Class B GPCRs
    80045 (GPR157)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 Dicty_CAR Frizzled 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 80045
NCBI-ProteinID: NP_079256
HGNC: 23687
Ensembl: ENSG00000180758
Vega: OTTHUMG00000001758
Pharos: Q5UAW9(Tdark)
UniProt: Q5UAW9
Position
1p36.22
AA seq 335 aa AA seqDB search
MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLS
AASYFYGVLQNFAGPSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRL
LWAFHVVSWGVPLVITVAAVALKKIGYDASDVSVGWCWIDLEAKDHVLWMLLTGKLWEML
AYVLLPLLYLLVRKHINRAHTALSEYRPILSQEHRLLRHSSMADKKLVLIPLIFIGLRVW
STVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSS
QPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgtccccgccgcccaccgagctggtgccgtcggagcgcgccgtggtgctgctg
tcgtgcgcactctccgcgctcggctcgggcctgctggtggccacgcacgccctgtggccc
gacctgcgcagccgggcacggcgcctgctgctcttcctgtcgctggccgacctgctctcg
gccgcctcctacttctacggagtgctgcagaacttcgcgggcccgtcgtgggactgcgtg
ctgcagggcgcgctgtccaccttcgccaacaccagctccttcttctggaccgtggccatt
gcgctctacttgtacctcagcatcgtccgcgccgcgcgcgggcctcgcacagatcgcctg
ctttgggccttccatgtcgtcagctggggggtcccgttggtcatcactgtggcagccgtc
gccctgaagaagattggctatgacgcctcggacgtgtctgtgggctggtgctggatcgac
ctggaggccaaggaccatgtcctgtggatgctgctgacggggaagctgtgggagatgctg
gcatatgtgctgctgcctctgctgtacctcctggtccggaagcacatcaacagagcgcac
acggcactctctgagtaccggcccatcctctcccaggagcaccgcctgctgcgccactcc
tccatggcggacaagaagctggtgctcatcccgctcatcttcatcggcctcagggtctgg
agcaccgtgcggttcgtgctgaccctctgtggctccccggccgtgcagacgccggtgctg
gtggttctgcatggtatcgggaacacgtttcagggaggtgccaactgcatcatgttcgtc
ctctgcacccgcgccgtccgaactcggctcttctctctctgttgctgctgctgctcttct
cagcctcccaccaagagcccggctggcactcccaaggctcccgcgccttccaagccagga
gaatctcaggaatcccaagggaccccaggggaacttccaagcacctga

DBGET integrated database retrieval system