KEGG   Homo sapiens (human): 80045Help
Entry
80045             CDS       T01001                                 

Gene name
GPR157
Definition
(RefSeq) G protein-coupled receptor 157
  KO
K08467  
G protein-coupled receptor 157
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Other
   Putative / unclassified Class B GPCRs
    80045 (GPR157)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
1p36.23
AA seq 335 aa AA seqDB search
MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLS
AASYFYGVLQNFAGPSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRL
LWAFHVVSWGVPLVITVAAVALKKIGYDASDVSVGWCWIDLEAKDHVLWMLLTGKLWEML
AYVLLPLLYLLVRKHINRAHTALSEYRPILSQEHRLLRHSSMADKKLVLIPLIFIGLRVW
STVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSS
QPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgtccccgccgcccaccgagctggtgccgtcggagcgcgccgtggtgctgctg
tcgtgcgcactctccgcgctcggctcgggcctgctggtggccacgcacgccctgtggccc
gacctgcgcagccgggcacggcgcctgctgctcttcctgtcgctggccgacctgctctcg
gccgcctcctacttctacggagtgctgcagaacttcgcgggcccgtcgtgggactgcgtg
ctgcagggcgcgctgtccaccttcgccaacaccagctccttcttctggaccgtggccatt
gcgctctacttgtacctcagcatcgtccgcgccgcgcgcgggcctcgcacagatcgcctg
ctttgggccttccatgtcgtcagctggggggtcccgttggtcatcactgtggcagccgtc
gccctgaagaagattggctatgacgcctcggacgtgtctgtgggctggtgctggatcgac
ctggaggccaaggaccatgtcctgtggatgctgctgacggggaagctgtgggagatgctg
gcatatgtgctgctgcctctgctgtacctcctggtccggaagcacatcaacagagcgcac
acggcactctctgagtaccggcccatcctctcccaggagcaccgcctgctgcgccactcc
tccatggcggacaagaagctggtgctcatcccgctcatcttcatcggcctcagggtctgg
agcaccgtgcggttcgtgctgaccctctgtggctccccggccgtgcagacgccggtgctg
gtggttctgcatggtatcgggaacacgtttcagggaggtgccaactgcatcatgttcgtc
ctctgcacccgcgccgtccgaactcggctcttctctctctgttgctgctgctgctcttct
cagcctcccaccaagagcccggctggcactcccaaggctcccgcgccttccaagccagga
gaatctcaggaatcccaagggaccccaggggaacttccaagcacctga

DBGET integrated database retrieval system