KEGG   Homo sapiens (human): 80055Help
Entry
80055             CDS       T01001                                 

Gene name
PGAP1, Bst1, ISPD3024, MRT42, SPG67
Definition
(RefSeq) post-GPI attachment to proteins 1
  KO
K05294  
glycosylphosphatidylinositol deacylase [EC:3.-.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
Metabolic pathways
Disease
H00768  
Nonsyndromic autosomal recessive mental retardation (NS-ARMR)
H01485  
Autosomal recessive mental retardation-42 (MRT42)
H01489  
Inherited glycosylphosphatidylinositol (GPI) deficiencies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    80055 (PGAP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     80055 (PGAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q75T13(Tdark)
UniProt: 
Position
2q33.1
AA seq 922 aa AA seqDB search
MFLHSVNLWNLAFYVFMVFLATLGLWDVFFGFEENKCSMSYMFEYPEYQKIELPKKLAKR
YPAYELYLYGEGSYAEEHKILPLTGIPVLFLPGNAGSYKQVRSIGSIALRKAEDIDFKYH
FDFFSVNFNEELVALYGGSLQKQTKFVHECIKTILKLYKGQEFAPKSVAIIGHSMGGLVA
RALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSV
AGGFRDYQVRSGLTFLPKLSHHTSALSVVSSAVPKTWVSTDHLSIVWCKQLQLTTVRAFF
DLIDADTKQITQNSKKKLSVLYHHFIRHPSKHFEENPAIISDLTGTSMWVLVKVSKWTYV
AYNESEKIYFTFPLENHRKIYTHVYCQSTMLDTNSWIFACINSTSMCLQGVDLSWKAELL
PTIKYLTLRLQDYPSLSHLVVYVPSVRGSKFVVDCEFFKKEKRYIQLPVTHLFSFGLSSR
KVVLNTNGLYYNLELLNFGQIYQAFKINVVSKCSAVKEEITSIYRLHIPWSYEDSLTIAQ
APSSTEISLKLHIAQPENNTHVALFKMYTSSDCRYEVTVKTSFSQILGQVVRFHGGALPA
YVVSNILLAYRGQLYSLFSTGCCLEYATMLDKEAKPYKVDPFVIIIKFLLGYKWFKELWD
VLLLPELDAVILTCQSMCFPLISLILFLFGTCTAYWSGLLSSASVRLLSSLWLALKRPSE
LPKDIKMISPDLPFLTIVLIIVSWTTCGALAILLSYLYYVFKVVHLQASLTTFKNSQPVN
PKHSRRSEKKSNHHKDSSIHHLRLSANDAEDSLRMHSTVINLLTWIVLLSMPSLIYWLKN
LRYYFKLNPDPCKPLAFILIPTMAILGNTYTVSIKSSKLLKTTSQFPLPLAVGVIAFGSA
HLYRLPCFVFIPLLLHALCNFM
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttcactcagttaatctctggaacctggcgttttatgtcttcatggtctttctg
gcaaccctggggctgtgggatgtcttcttcggcttcgaggagaataagtgcagtatgagc
tacatgtttgagtacccggagtatcagaaaatagaacttccaaagaaactggcaaaacgc
tatcccgcatatgagttgtatctttatggagagggatcctatgctgaagaacacaaaatt
ctccctttgacgggtattccagttctctttcttcctggtaatgctggaagttataagcaa
gttcgttctattggctccattgcacttagaaaagcagaggacattgacttcaagtaccac
tttgacttctttagtgtgaacttcaatgaagaactggtggctttgtatggtggaagtctt
cagaagcagaccaagtttgtacatgaatgtattaaaacaattctcaaactctataagggt
caagaatttgctccaaaaagtgtggcaataattggtcattctatgggtggccttgttgca
agagcattgcttacactgaaaaattttaagcatgatctgataaatcttcttattacacaa
gccacacctcatgttgctcctgtgatgccattagatcgtttcattacagatttttatacg
actgtaaacaactattggattctaaatgctcgacacataaatttaaccacactttctgta
gctggaggattccgggattaccaagttcgttcaggattgacttttctaccaaaattaagc
catcataccagtgccttatctgttgtgagttcagcagtgcctaagacctgggtctcaaca
gaccacctctccattgtgtggtgtaaacaattgcagttgactacagttcgagcattcttt
gatcttattgatgctgatactaaacaaataactcaaaattccaagaagaaactgtcagtt
ttgtatcaccactttataagacacccatcaaaacattttgaggaaaatccagctataatt
tctgacttaacagggacatctatgtgggttctagtaaaagtgtccaaatggacctatgta
gcttacaacgaatctgagaagatatattttacatttcctcttgaaaatcatagaaaaatc
tacactcatgtctattgtcagagcactatgctggatacaaatagttggatttttgcttgc
ataaacagcacttctatgtgcctgcaaggggttgatttatcatggaaagctgaactgctg
ccaacaattaagtatctgacattaagacttcaagactatccatctttgtctcatcttgtt
gtttatgtaccatctgttcgtggaagtaagtttgttgtagattgtgaattctttaaaaaa
gagaaaagatacatacagcttcctgtaactcatcttttttcctttggattgtcttcaagg
aaagtggtgttaaatacaaatggcctatactacaatctagagcttctgaactttggacag
atataccaagcttttaaaatcaacgtggtaagcaagtgctcagcagtcaaagaagaaata
accagtatctatagacttcatattccttggtcttatgaagattcactaaccattgcacag
gctccatcttccacagaaatttctctgaaactccatattgctcaaccagaaaacaatacc
catgtggcattatttaaaatgtacacgtcatcagactgtcggtacgaggtgacagttaag
acttccttttcacaaatacttggacaggtagttagatttcatggtggagctcttcctgct
tatgtcgtatctaatatccttcttgcttatagaggacagttatattctcttttctcaaca
ggttgttgcttagaatatgctaccatgttggataaagaagccaaaccatacaaagttgat
ccttttgtaattatcattaagtttctgttggggtataaatggtttaaagaattgtgggat
gtattattgttaccagaattagatgccgtcattttaacttgtcagagtatgtgtttcccc
ctgatatccttgattctctttctgtttggaacgtgtactgcctactggagtggcctactg
tcttctgcatctgtgagacttctttcttcattgtggctagctttgaaaagaccctctgaa
cttcctaaagatatcaagatgatatcaccagacttgccctttttgacaattgtcttgatc
atagttagttggacaacttgtggagcactagccatacttctttcttatctttactatgtg
tttaaggttgttcatctgcaagccagcttaacaacttttaagaatagccagcctgtgaat
cccaaacactctagaagaagtgaaaagaaatccaatcatcataaagactcctcaatacac
catcttcgtttatctgccaacgatgctgaagatagccttcgcatgcacagtactgtgatt
aacttactaacatggattgtattactcagcatgccttctctaatttattggctaaagaat
cttaggtattattttaaacttaatcctgatccatgtaaacctttggcatttatccttatt
ccgactatggcaattcttggaaatacttacactgtttcaataaaatcaagtaaattgttg
aagactacttcacaatttccacttcctctggctgttggtgtgattgcttttgggtcagca
catttatataggcttccatgctttgtcttcattcctcttttactccatgcattatgcaac
tttatgtaa

DBGET integrated database retrieval system