KEGG   Homo sapiens (human): 80145Help
Entry
80145             CDS       T01001                                 

Gene name
THOC7, NIF3L1BP1, fSAP24, hTREX30
Definition
THO complex 7 homolog (Drosophila)
Orthology
K13176  
THO complex subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
THC complex
TREX complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p14.1
AA seq 152 aa AA seqDB search
MLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRI
RKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLS
TIHELQQTLENDEKLSEVEEAQEASMETDPKP
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcacgctgtctcaatgtgaattttcaatgggcaaaactttactagtatatgat
atgaatctcagagaaatggaaaattatgaaaaaatttacaaggaaatagaatgtagcata
gctggagcacatgaaaaaattgctgagtgcaaaaagcaaattcttcaagcaaaacgaata
cgaaaaaatcgccaagaatatgatgctttggcaaaagtgattcagcaccatccagacagg
catgagacattaaaggaactagaggctctgggaaaagaattagagcatctttcacacatt
aaagaaagtgttgaagataagctggaattgagacggaaacagtttcatgttcttcttagt
accatccatgaacttcagcaaacattggaaaatgatgaaaaactctcagaggtagaagaa
gctcaggaagcaagcatggaaacagatcctaagccatag

DBGET integrated database retrieval system