KEGG   Homo sapiens (human): 80145Help
Entry
80145             CDS       T01001                                 

Gene name
THOC7, NIF3L1BP1, fSAP24, hTREX30
Definition
(RefSeq) THO complex 7
  KO
K13176  THO complex subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Module
hsa_M00405  THC complex
hsa_M00406  TREX complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    80145 (THOC7)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    TREX complex
     80145 (THOC7)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    80145 (THOC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: THOC7 UPF0193 EcoEI_R_C DASH_Dad2 Spc7 COG2 DUF4407
Motif
Other DBs
NCBI-GeneID: 80145
NCBI-ProteinID: NP_079351
OMIM: 611965
HGNC: 29874
Ensembl: ENSG00000163634
Vega: OTTHUMG00000158767
Pharos: Q6I9Y2(Tbio)
UniProt: Q6I9Y2 A0A024R332
Position
3p14.1
AA seq 204 aa AA seqDB search
MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQC
EFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYD
ALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQT
LENDEKLSEVEEAQEASMETDPKP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgggagccgtgactgacgacgaagttatacggaagcgtctcctcattgatggagatggt
gctggagatgatcggagaattaatctgctagtgaagagtttcattaaatggtgcaactct
gggtcccaggaagagggatatagccagtaccaacgtatgctgagcacgctgtctcaatgt
gaattttcaatgggcaaaactttactagtatatgatatgaatctcagagaaatggaaaat
tatgaaaaaatttacaaggaaatagaatgtagcatagctggagcacatgaaaaaattgct
gagtgcaaaaagcaaattcttcaagcaaaacgaatacgaaaaaatcgccaagaatatgat
gctttggcaaaagtgattcagcaccatccagacaggcatgagacattaaaggaactagag
gctctgggaaaagaattagagcatctttcacacattaaagaaagtgttgaagataagctg
gaattgagacggaaacagtttcatgttcttcttagtaccatccatgaacttcagcaaaca
ttggaaaatgatgaaaaactctcagaggtagaagaagctcaggaagcaagcatggaaaca
gatcctaagccatag

DBGET integrated database retrieval system