KEGG   Homo sapiens (human): 80146Help
Entry
80146             CDS       T01001                                 

Gene name
UXS1, SDR6E1, UGD
Definition
(RefSeq) UDP-glucuronate decarboxylase 1
  KO
K08678  
UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
hsa  Homo sapiens (human)
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    80146 (UXS1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     80146 (UXS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q8NBZ7(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2q12.2
AA seq 420 aa AA seqDB search
MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMRSIQENGELKIESKIEEMVE
PLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDN
FFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNT
IGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAET
MCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQ
YVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQK
RKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcaaggcgctgctgcgcctcgtgtctgccgtcaaccgcaggaggatgaagctg
ctgctgggcatcgccttgctggcctacgtcgcctctgtttggggcaacttcgttaatatg
aggtctatccaggaaaatggtgaactaaaaattgaaagcaagattgaagagatggttgaa
ccactaagagagaaaatcagagatttagaaaaaagctttacccagaaatacccaccagta
aagtttttatcagaaaaggatcggaaaagaattttgataacaggaggcgcagggttcgtg
ggctcccatctaactgacaaactcatgatggacggccacgaggtgaccgtggtggacaat
ttcttcacgggcaggaagagaaacgtggagcactggatcggacatgagaacttcgagttg
attaaccacgacgtggtggagcccctctacatcgaggttgaccagatataccatctggca
tctccagcctcccctccaaactacatgtataatcctatcaagacattaaagaccaatacg
attgggacattaaacatgttggggctggcaaaacgagtcggtgcccgtctgctcctggcc
tccacatcggaggtgtatggagatcctgaagtccaccctcaaagtgaggattactggggc
cacgtgaatccaataggacctcgggcctgctacgatgaaggcaaacgtgttgcagagacc
atgtgctatgcctacatgaagcaggaaggcgtggaagtgcgagtggccagaatcttcaac
acctttgggccacgcatgcacatgaacgatgggcgagtagtcagcaacttcatcctgcag
gcgctccagggggagccactcacggtatacggatccgggtctcagacaagggcgttccag
tacgtcagcgatctagtgaatggcctcgtggctctcatgaacagcaacgtcagcagcccg
gtcaacctggggaacccagaagaacacacaatcctagaatttgctcagttaattaaaaac
cttgttggtagcggaagtgaaattcagtttctctccgaagcccaggatgacccacagaaa
agaaaaccagacatcaaaaaagcaaagctgatgctggggtgggagcccgtggtcccgctg
gaggaaggtttaaacaaagcaattcactacttccgtaaagaactcgagtaccaggcaaat
aatcagtacatccccaaaccaaagcctgccagaataaagaaaggacggactcgccacagc
tga

DBGET integrated database retrieval system