KEGG   Homo sapiens (human): 80146Help
Entry
80146             CDS       T01001                                 

Gene name
UXS1, SDR6E1, UGD
Definition
UDP-glucuronate decarboxylase 1 (EC:4.1.1.35)
Orthology
K08678  
UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
hsa  Homo sapiens (human)
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hsa00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hsa00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q12.2
AA seq 425 aa AA seqDB search
MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMSFLLNRSIQENGELKIESKI
EEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEV
TVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKT
LKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGK
RVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQ
TRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQ
DDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKG
RTRHS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcaaggcgctgctgcgcctcgtgtctgccgtcaaccgcaggaggatgaagctg
ctgctgggcatcgccttgctggcctacgtcgcctctgtttggggcaacttcgttaatatg
agctttctactcaacaggtctatccaggaaaatggtgaactaaaaattgaaagcaagatt
gaagagatggttgaaccactaagagagaaaatcagagatttagaaaaaagctttacccag
aaatacccaccagtaaagtttttatcagaaaaggatcggaaaagaattttgataacagga
ggcgcagggttcgtgggctcccatctaactgacaaactcatgatggacggccacgaggtg
accgtggtggacaatttcttcacgggcaggaagagaaacgtggagcactggatcggacat
gagaacttcgagttgattaaccacgacgtggtggagcccctctacatcgaggttgaccag
atataccatctggcatctccagcctcccctccaaactacatgtataatcctatcaagaca
ttaaagaccaatacgattgggacattaaacatgttggggctggcaaaacgagtcggtgcc
cgtctgctcctggcctccacatcggaggtgtatggagatcctgaagtccaccctcaaagt
gaggattactggggccacgtgaatccaataggacctcgggcctgctacgatgaaggcaaa
cgtgttgcagagaccatgtgctatgcctacatgaagcaggaaggcgtggaagtgcgagtg
gccagaatcttcaacacctttgggccacgcatgcacatgaacgatgggcgagtagtcagc
aacttcatcctgcaggcgctccagggggagccactcacggtatacggatccgggtctcag
acaagggcgttccagtacgtcagcgatctagtgaatggcctcgtggctctcatgaacagc
aacgtcagcagcccggtcaacctggggaacccagaagaacacacaatcctagaatttgct
cagttaattaaaaaccttgttggtagcggaagtgaaattcagtttctctccgaagcccag
gatgacccacagaaaagaaaaccagacatcaaaaaagcaaagctgatgctggggtgggag
cccgtggtcccgctggaggaaggtttaaacaaagcaattcactacttccgtaaagaactc
gagtaccaggcaaataatcagtacatccccaaaccaaagcctgccagaataaagaaagga
cggactcgccacagctga

DBGET integrated database retrieval system