KEGG   Homo sapiens (human): 80153Help
Entry
80153             CDS       T01001                                 

Gene name
EDC3, LSM16, MRT50, YJDC, YJEFN2
Definition
(RefSeq) enhancer of mRNA decapping 3
  KO
K12615  
enhancer of mRNA-decapping protein 3
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Module
Decapping complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    80153 (EDC3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     80153 (EDC3)
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     80153 (EDC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q24.1
AA seq 508 aa AA seqDB search
MATDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDIT
ELKILEIPGPGDNQHFGDLHQTELGPSGAGCQVGINQNGTGKFVKKPASSSSAPQNIPKR
TDVKSQDVAVSPQQQQCSKSYVDRHMESLSQSKSFRRRHNSWSSSSRHPNQATPKKSGLK
NGQMKNKDDECFGDDIEEIPDTDFDFEGNLALFDKAAVFEEIDTYERRSGTRSRGIPNER
PTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLT
LERRLEMTGVCASQMALTLLGGPNRLNPKNVHQRPTVALLCGPHVKGAQGISCGRHLANH
DVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLR
DQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIG
IPQQVFQEVGINYHSPFGCKFVIPLHSA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggctacagattggctgggaagtattgtgtccatcaattgtggagatagcttgggtgtc
tatcagggaagagtgtcagctgtggatcaggtcagccagaccatttctctcacccggcct
ttccataatggagtgaagtgtcttgttccagaagtcaccttcagggcaggtgacattacg
gagttaaaaattctggagataccaggacctggagacaaccaacattttggagaccttcat
caaacagaattaggcccctctggtgctggctgccaagtgggcatcaatcagaatggcaca
ggcaagtttgtcaagaagccagcctcttccagcagtgcccctcagaatatccctaagagg
acagatgtgaagagccaggatgttgccgtttccccgcagcagcaacagtgctcaaagagc
tatgtcgacaggcacatggaatccttgagtcagtccaaaagtttccgtcgtcggcacaac
tcctggtcatctagtagcaggcacccaaatcaggcaactcccaagaaaagtggtttaaag
aatggccagatgaagaataaagatgacgagtgcttcggggatgatattgaggagatccca
gacacagattttgattttgaagggaacctggctctttttgacaaggcagctgtgtttgag
gagattgatacctatgaaaggagaagtggtacccgttcccggggcatcccaaatgaaagg
cccactcggtaccgccatgatgagaacatcttggagtccgagcccattgtctatcgacgg
atcatagtgccccacaacgtgagcaaggagttctgcacggactctggcctggttgtccca
agtatttcctatgagctgcataaaaagctgttgtccgtggctgagaagcatgggctgacc
cttgagcggagactggagatgacaggtgtgtgtgccagtcagatggcactgaccctcctc
ggaggacctaacaggttgaatcccaaaaatgttcaccagaggcctacagtggctctactg
tgtggacctcatgtgaagggggctcagggtatcagctgtggaaggcacctagccaaccat
gatgtccaggtcatccttttcctgcccaattttgtcaagatgttggaatctatcaccaat
gagctgtcgctcttcagcaagacccaaggccaacaagtgtctagcctcaaagatctgccc
actagccctgtggacctggtcatcaactgcctggattgccctgagaacgtcttcctgcgc
gatcaaccctggtacaaggcagctgtggcctgggccaaccagaaccgggcaccagtactc
agcatagaccctcctgtgcatgaagtcgaacagggcattgatgccaaatggtcactggca
ctgggcctgcctctgccactgggggagcacgcaggccgtatctatttgtgcgacattggc
attccccagcaggtcttccaggaggtgggcatcaactaccactcgccctttggctgcaag
tttgttatcccactgcactctgcttag

DBGET integrated database retrieval system