KEGG   Homo sapiens (human): 80168Help
Entry
80168             CDS       T01001                                 

Gene name
MOGAT2, DGAT2L5, MGAT2
Definition
monoacylglycerol O-acyltransferase 2 (EC:2.3.1.22)
Orthology
K14457  
2-acylglycerol O-acyltransferase 2 [EC:2.3.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    80168 (MOGAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.22  2-acylglycerol O-acyltransferase
     80168 (MOGAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
11q13.5
AA seq 334 aa AA seqDB search
MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLD
RDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFAN
LCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNL
LGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSG
SWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEE
VNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggtagagttcgcgcccttgtttatgccgtgggagcgcaggctgcagacacttgctgtc
ctacagtttgtcttctccttcttggcactggccgagatctgcactgtgggcttcatagcc
ctcctgtttacaagattctggctcctcactgtcctgtatgcggcctggtggtatctggac
cgagacaagccacggcaggggggccggcacatccaggccatcaggtgctggactatatgg
aagtacatgaaggactatttccccatctcgctggtcaagactgctgagctggacccctct
cggaactacattgcgggcttccacccccatggagtcctggcagtcggagcctttgccaac
ctgtgcactgagagcacaggcttctcttcgatcttccccggtatccgcccccatctgatg
atgctgaccttgtggttccgggcccccttcttcagagattacatcatgtctgcagggttg
gtcacatcagaaaaggagagtgctgctcacattctgaacaggaagggtggcggaaacttg
ctgggcatcattgtagggggtgcccaggaggccctggatgccaggcctggatccttcacg
ctgttactgcggaaccgaaagggcttcgtcaggctcgccctgacacacggggcacccctg
gtgccaatcttctccttcggggagaatgacctatttgaccagattcccaactcttctggc
tcctggttacgctatatccagaatcggttgcagaagatcatgggcatctccctcccactc
tttcatggccgtggtgtcttccagtacagctttggtttaataccctaccgccggcccatc
accactgtggtggggaagcccatcgaggtacagaagacgctgcatccctcggaggaggag
gtgaaccagctgcaccagcgttatatcaaagagctgtgcaacctcttcgaggcccacaaa
cttaagttcaacatccctgctgaccagcacttggagttctgctga

DBGET integrated database retrieval system