KEGG   Homo sapiens (human): 80201Help
Entry
80201             CDS       T01001                                 

Gene name
HKDC1
Definition
(RefSeq) hexokinase domain containing 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00051  Fructose and mannose metabolism
hsa00052  Galactose metabolism
hsa00500  Starch and sucrose metabolism
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa00524  Neomycin, kanamycin and gentamicin biosynthesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04066  HIF-1 signaling pathway
hsa04910  Insulin signaling pathway
hsa04930  Type II diabetes mellitus
hsa04973  Carbohydrate digestion and absorption
hsa05230  Central carbon metabolism in cancer
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Drug target
Lonidamine: D07257
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    80201 (HKDC1)
   00051 Fructose and mannose metabolism
    80201 (HKDC1)
   00052 Galactose metabolism
    80201 (HKDC1)
   00500 Starch and sucrose metabolism
    80201 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    80201 (HKDC1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    80201 (HKDC1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    80201 (HKDC1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    80201 (HKDC1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    80201 (HKDC1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    80201 (HKDC1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    80201 (HKDC1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     80201 (HKDC1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    80201 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 80201
NCBI-ProteinID: NP_079406
OMIM: 617221
HGNC: 23302
Ensembl: ENSG00000156510
Vega: OTTHUMG00000018371
Pharos: Q2TB90(Tbio)
UniProt: Q2TB90 B3KT70
Position
10q22.1
AA seq 917 aa AA seqDB search
MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAA
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIR
GNGTELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGV
QDTDVVSRLTKAMRRHKDMDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLANTREILVDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKVERLRTTVGMDGTLYKIH
PQYPKRLHKVVRKLVPSCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDRVLALFQLT
REQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGASLPLGFT
FSFPCRQMSIDKGTLIGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGYEDPNCEIGLIAGTGSNMCYMEDMRNIEMVEGGEGKMCINTEWGGFGDNGCIDDI
RTRYDTEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI
VEKRREDQGLEHLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKGA
ALITAVAKRLQQAQKEN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggtccacttgatggcattttacttcagcaagctgaaggaggaccagatcaag
aaggtggacaggttcctgtatcacatgcggctctccgatgacacccttttggacatcatg
aggcggttccgggctgagatggagaagggcctggcaaaggacaccaaccccacggctgca
gtgaagatgttgcccaccttcgtcagggccattcccgatggttccgaaaatggggagttc
ctttccctggatctcggagggtccaagttccgagtgctgaaggtgcaagtcgctgaagag
gggaagcgacacgtgcagatggagagtcagttctacccaacgcccaatgaaatcatccgc
gggaacggcacagagctgtttgaatatgtagctgactgtctggcagatttcatgaagacc
aaagatttaaagcataagaaattgccccttggcctaactttttctttcccctgtcgacag
actaaactggaagagggtgtcctactttcgtggacaaaaaagtttaaggcacgaggagtt
caggacacggatgtggtgagccgtctgaccaaagccatgagaagacacaaggacatggac
gtggacatcctggccctggtcaatgacaccgtggggaccatgatgacctgtgcctatgac
gacccctactgcgaagttggtgtcatcatcggaactggcaccaatgcgtgttacatggag
gacatgagcaacattgacctggtggagggcgacgagggcaggatgtgcatcaacacagag
tggggggccttcggggacgacggggccctggaggacattcgcactgagttcgacagggag
ctggacctcggctctctcaacccaggaaagcaactgttcgagaagatgatcagtggcctg
tacctgggggagcttgtcaggcttatcttgctgaagatggccaaggctggcctcctgttt
ggtggtgagaaatcttctgctctccacactaagggcaagatcgaaacacggcacgtggct
gccatggagaagtataaagaaggccttgctaatacaagagagatcctggtggacctgggt
ctggaaccgtctgaggctgactgcattgccgtccagcatgtctgtaccatcgtctccttc
cgctcggccaatctctgtgcagcagctctggcggccatcctgacacgcctccgggagaac
aagaaggtggaacggctccggaccacagtgggcatggacggcaccctctacaagatacac
cctcagtacccaaaacgcctgcacaaggtggtgaggaaactggtcccaagctgtgatgtc
cgcttcctcctgtcagagagtggcagcaccaagggggccgccatggtgaccgcggtggcc
tcccgcgtgcaggcccagcggaagcagatcgacagggtgctggctttgttccagctgacc
cgagagcagctcgtggacgtgcaggccaagatgcgggctgagctggagtatgggctgaag
aagaagagccacgggctggccacggtcaggatgctgcccacctacgtctgcgggctgccg
gacggcacagagaaaggaaagtttctcgccctggatcttgggggaaccaacttccgggtc
ctcctggtgaagatcagaagtggacggaggtcagtgcgaatgtacaacaagatcttcgcc
atccccctggagatcatgcagggcactggtgaggagctctttgatcacattgtgcagtgc
atcgccgacttcctggactacatgggcctcaagggagcctccctacctttgggcttcaca
ttctcatttccctgcaggcagatgagcattgacaagggaacactcatagggtggaccaaa
ggtttcaaggccactgactgtgaaggggaggacgtggtggacatgctcagggaagccatc
aagaggagaaacgagtttgacctggacattgttgcagtcgtgaatgatacagtggggacc
atgatgacctgtggctatgaagatcctaattgtgagattggcctgattgcaggaacaggc
agcaacatgtgctacatggaggacatgaggaacatcgagatggtggaggggggtgaaggg
aagatgtgcatcaatacagagtggggaggatttggagacaatggctgcatagatgacatc
cggacccgatacgacacggaggtggatgaggggtccttgaatcctggcaagcagagatac
gagaaaatgaccagtgggatgtacttgggggagattgtgcggcagatcctgatcgacctg
accaagcagggtctcctcttccgagggcagatttcagagcgtctccggaccaggggcatc
ttcgaaaccaagttcctgtcccagatcgaaagcgatcggctggcccttctccaggtcagg
aggattctgcagcagctgggcctggacagcacgtgtgaggacagcatcgtggtgaaggag
gtgtgcggagccgtgtcccggcgggcggcccagctctgcggtgctggcctggccgctata
gtggaaaaaaggagagaagaccaggggctagagcacctgaggatcactgtgggtgtggac
ggcaccctgtacaagctgcaccctcacttttctagaatattgcaggaaactgtgaaggaa
ctagcccctcgatgtgatgtgacattcatgctgtcagaagatggcagtggaaaaggggca
gcactgatcactgctgtggccaagaggttacagcaggcacagaaggagaactag

DBGET integrated database retrieval system