KEGG   Homo sapiens (human): 8021Help
Entry
8021              CDS       T01001                                 

Gene name
NUP214, CAIN, CAN, D9S46E, N214, p250
Definition
nucleoporin 214kDa
Orthology
K14317  
nuclear pore complex protein Nup214
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Epstein-Barr virus infection
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    8021 (NUP214)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    8021 (NUP214)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.1
AA seq 2090 aa AA seqDB search
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKYGLVFAGGASGLQ
IFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEYGSII
AFFDVRTFSNEAKQQKRPFAYHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQYLPTLQEKKVIPCPPFYESDHP
VRVLDVLWIGTYVFAIVYAAADGTLETSPDVVMALLPKKEEKHPEIFVNFMEPCYGSCTE
RQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDYTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFYMINQNPGVKSLIKTPERL
SLEGERQPKSPGSTPTTPTSSQAPQKLDASAAAAPASLPPSSPAAPIATFSLLPAGGAPT
VFSFGSSSLKSSATVTGEPPSYSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPV
SSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKSSVLPSPSGRSAQGSSSPVP
SMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVE
EAREQNERNRDSGYLHLLYKRPLDPKSEAQLQEIRRLHQYVKFAVQDVNDVLDLEWDQHL
EQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVR
STAPASLSRSAFLSQRYYEDLDEVSSTSSVSQSLESEDARTSCKDDEAVVQAPRHAPVVR
TPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAP
SPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMG
SSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGPTPASGQLSSGDKASGTAKIETAV
TSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGG
SKPSYEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGEL
LFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSLTSTQPTKTSGVPSGFNFTAPPVL
GKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFS
FGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSA
LPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSVKKEPVLAQPAVSNSGTAASSTSL
VALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASST
TSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAAS
TAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTAPGVFGQTTFGQASVFGQSASSAA
SVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQ
SNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASGFGSSNTGSVFGQAASTGGI
VFGQQSSSSSGSVFGSGNTGRGGGFFSGLGGKPSQDAANKNPFSSASGGFGSTATSNTSN
LFGNSGAKTFGGFASSSFGEQKPTGTFSSGGGSVASQGFGFSSPNKTGGFGAAPVFGSPP
TFGGSPGFGGVPAFGSAPAFTSPLGSTGGKVFGEGTAAASAGGFGFGSSSNTTSFGTLAS
QNAPTFGSLSQQTSGFGTQSSGFSGFGSGTGGFSFGSNNSSVQGFGGWRS
NT seq 6273 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgagatggatgccatgattcccgagcgggagatgaaggattttcagtttaga
gcgctaaagaaggtgagaatctttgactcccctgaggaattgcccaaggaacgctcgagt
ctgcttgctgtgtccaacaaatatggtctggtcttcgctggtggagccagtggcttgcag
atttttcctactaaaaatcttcttattcaaaataaacccggagatgatcccaacaaaata
gttgataaagtccaaggcttgctagttcctatgaaattcccaatccatcacctggccttg
agctgtgataacctcacactctctgcgtgcatgatgtccagtgaatatggttccattatt
gctttttttgatgttcgcacattctcaaatgaggctaaacagcaaaaacgcccatttgcc
tatcataagcttttgaaagatgcaggaggcatggtgattgatatgaagtggaaccccact
gtcccctccatggtggcagtttgtctggctgatggtagtattgctgtcctgcaagtcacg
gaaacagtgaaagtatgtgcaactcttccttccacggtagcagtaacctctgtgtgctgg
agccccaaaggaaagcagctggcagtgggaaaacagaatggaactgtggtccagtatctt
cctactttgcaggaaaaaaaagtcattccttgtcctccgttttatgagtcagatcatcct
gtcagagttctggatgtgctgtggattggtacctacgtcttcgccatagtgtatgctgct
gcagatgggaccctggaaacgtctccagatgtggtgatggctctactaccgaaaaaagaa
gaaaagcacccagagatatttgtgaactttatggagccctgttatggcagctgcacggag
agacagcatcattactacctcagttacattgaggaatgggatttagtgctggcagcatct
gcggcttcaacagaagttagtatccttgctcgacaaagtgatcagattaattgggaatct
tggctactggaggattctagtcgagctgaattgcctgtgacagacaagagtgatgactcc
ttgcccatgggagttgtcgtagactatacaaaccaagtggaaatcaccatcagtgatgaa
aagactcttcctcctgctccagttctcatgttactttcaacagatggtgtgctttgtcca
ttttatatgattaatcaaaatcctggggttaagtctctcatcaaaacaccagagcgactt
tcattagaaggagagcgacagcccaagtcaccaggaagtactcccactaccccaacctcc
tctcaagccccacagaaactggatgcttctgcagctgcagcccctgcctctctgccacct
tcatcacctgctgctcccattgccactttttctttgcttcctgctggtggagcccccact
gtgttctcctttggttcttcatctttgaagtcatctgctacggtcactggggagccccct
tcatattccagtggctccgacagctccaaagcagccccaggccctggcccatcaaccttc
tcttttgttcccccttctaaagcctccctagcccccacccctgcagcgtctcctgtggct
ccatcagctgcttcattctcctttggatcatctggttttaagcctaccctggaaagcaca
ccagtgccaagtgtgtctgctccaaatatagcaatgaagccctccttcccaccctcaacc
tctgctgtcaaagtcaaccttagtgaaaagtttactgctgcagctacctctactcctgtt
agtagctcccagagcgcacccccgatgtcgccattctcttctgcctccaagccagctgct
tctggaccactcagccaccccacacctctctcagcaccacctagttccgtgccattgaag
tcctcagtcttgccctcaccatcaggacgatctgctcagggcagttcaagcccagtgccc
tcaatggtacagaaatcacccaggataacccctccagcggcaaagccaggctctccccag
gcaaagtcacttcagcctgctgttgcagaaaagcagggacatcagtggaaagattcagat
cctgtaatggctggaattggggaggagattgcacactttcagaaggagttggaagagtta
aaagcccgaacttccaaagcctgtttccaagtgggcacttctgaggagatgaagatgctg
cgaacagaatcagatgacttgcatacctttcttttggagattaaagagaccacagagtcg
cttcatggagatataagtagcctgaaaacaactttacttgagggctttgctggtgttgag
gaagccagagaacaaaatgaaagaaatcgtgactctggttatctgcatttgctttataaa
agaccactggatcccaagagtgaagctcagcttcaggaaattcggcgccttcatcagtat
gtgaaatttgctgtccaagatgtgaatgatgttctagacttggagtgggatcagcatctg
gaacaaaagaaaaaacaaaggcacctgcttgtgccagagcgagagacactgtttaacacc
ctagccaacaatcgggaaatcatcaaccaacagaggaagaggctgaatcacctggtggat
agtcttcagcagctccgcctttacaaacagacttccctgtggagcctgtcctcggctgtt
ccttcccagagcagcattcacagttttgacagtgacctggaaagcctgtgcaatgctttg
ttgaaaaccaccatagaatctcacaccaaatccttgcccaaagtaccagccaaactgtcc
cccatgaaacaggcacaactgagaaacttcttggccaagaggaagaccccaccagtgaga
tccactgctccagccagcctgtctcgatcagcctttctgtctcagagatattatgaagac
ttggatgaagtcagctcaacgtcatctgtctcccagtctctggagagtgaagatgcacgg
acgtcctgtaaagatgacgaggcagtggttcaggcccctcggcacgcccccgtggttcgc
actccttccatccagcccagtctcttgccccatgcagcaccttttgctaaatctcacctg
gttcatggttcttcacctggtgtgatgggaacttcagtggctacatctgctagcaaaatt
attcctcaaggggccgatagcacaatgcttgccacgaaaaccgtgaaacatggtgcacct
agtccttcccaccccatctcagccccgcaggcagctgccgcagcagcactcaggcggcag
atggccagtcaggcaccagctgtaaacactttgactgaatcaacgttgaagaatgtccct
caagtggtaaatgtgcaggaattgaagaataaccctgcaaccccttctacagccatgggt
tcttcagtgccctactccacagccaaaacacctcacccagtgttgaccccagtggctgct
aaccaagccaagcaggggtctctaataaattcccttaagccatctgggcctacaccagca
tccggtcagttatcatctggtgacaaagcttcagggacagccaagatagaaacagctgtg
acttcaaccccatctgcttctgggcagttcagcaagcctttctcattttctccatcaggg
actggctttaattttgggataatcacaccaacaccgtcttctaatttcactgctgcacaa
ggggcaacaccctccactaaagagtcaagccagccggacgcattctcatctggtggggga
agcaaaccttcttatgaggccattcctgaaagctcacctccctcaggaatcacatccgca
tcaaacaccaccccaggagaacctgccgcatctagcagcagacctgtggcaccttctgga
actgctctttccaccacctctagtaagctggaaaccccaccgtccaagctgggagagctt
ctgtttccaagttctttggctggagagactctgggaagtttttcaggactgcgggttggc
caagcagatgattctacaaaaccaaccaataaggcttcatccacaagcctaactagtacc
cagccaaccaagacgtcaggcgtgccctcagggtttaattttactgcccccccggtgtta
gggaagcacacggagccccctgtgacatcctctgcaaccaccacctcagtagcaccacca
gcagccaccagcacttcctcaactgccgtttttggcagtctgccagtcaccagtgcagga
tcctctggggtcatcagttttggtgggacatctctaagtgctggcaagactagtttttca
tttggaagccaacagaccaatagcacagtgcccccatctgccccaccaccaactacagct
gccactccccttccaacatcattccccacattgtcatttggtagcctcctgagttcagca
actaccccctccctgcctatgtccgctggcagaagcacagaagaggccacttcatcagct
ttgcctgagaagccaggtgacagtgaggtctcagcatcagcagcctcacttctagaggag
caacagtcagcccagcttccccaggctcctccgcaaacttctgactctgttaaaaaagaa
cctgttcttgcccagcctgcagtcagcaactctggcactgcagcatctagtactagtctt
gtagcactttctgcagaggctaccccagccaccacgggggtccctgatgccaggacggag
gcagtaccacctgcttcctccttttctgtgcctgggcagactgctgtcacagcagctgct
atctcaagtgcaggccctgtggccgtcgaaacatcaagtacccccatagcctccagcacc
acgtccattgttgctcccggcccatctgcagaggcagcagcatttggtaccgtcacttct
ggctcatccgtctttgctcagcctcctgctgccagttctagctcagctttcaaccagctc
accaacaacacagccactgccccctctgccacgcccgtgtttgggcaagtggcagccagc
accgcaccaagtctgtttgggcagcagactggtagcacagccagcacagcagctgccaca
ccacaggtcagcagctcagggtttagcagcccagcttttggtaccacagccccaggggtc
tttggacagacaaccttcgggcaggcctcagtctttgggcagtcggcgagcagtgctgca
agtgtcttttccttcagtcagcctgggttcagttccgtgcctgccttcggtcagcctgct
tcctccactcccacatccaccagtggaagtgtctttggtgccgcctcaagtaccagtagc
tccagttccttctcatttggacagtcttctcccaacacaggaggggggctgtttggccaa
agcaacgctcctgcttttgggcagagtcctggctttggacagggaggctctgtctttggt
ggtacctcagctgccaccacaacagcagcaacctctgggttcagcttttgccaagcttca
ggttttgggtctagtaatactggttctgtgtttggtcaagcagccagtactggtggaata
gtctttggccagcaatcatcctcttccagtggtagcgtgtttgggtctggaaacactgga
agagggggaggtttcttcagtggccttggaggaaaacccagtcaggatgcagccaacaaa
aacccattcagctcggccagtgggggctttggatccacagctacctcaaatacctctaac
ctatttggaaacagtggggccaagacatttggtggatttgccagctcgtcgtttggagag
cagaaacccactggcactttcagctctggaggaggaagtgtggcatcccaaggctttggg
ttttcctctccaaacaaaacaggtggcttcggtgctgctccagtgtttggcagccctcct
acttttgggggatcccctgggtttggaggggtgccagcattcggttcagccccagccttt
acaagccctctgggctcgacgggaggcaaagtgttcggagagggcactgcagctgccagc
gcaggaggattcgggtttgggagcagcagcaacaccacatccttcggcacgctcgcgagt
cagaatgcccccactttcggatcactgtcccaacagacttctggttttgggacccagagt
agcggattctctggttttggatcaggcacaggagggttcagctttgggtcaaataactcg
tctgtccagggttttggtggctggcgaagctga

DBGET integrated database retrieval system