KEGG   Homo sapiens (human): 8021Help
Entry
8021              CDS       T01001                                 

Gene name
NUP214, CAIN, CAN
Definition
(RefSeq) nucleoporin 214kDa
  KO
K14317  
nuclear pore complex protein Nup214
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Epstein-Barr virus infection
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    8021 (NUP214)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    8021 (NUP214)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     8021 (NUP214)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.1
AA seq 2090 aa AA seqDB search
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKYGLVFAGGASGLQ
IFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEYGSII
AFFDVRTFSNEAKQQKRPFAYHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVT
ETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQYLPTLQEKKVIPCPPFYESDHP
VRVLDVLWIGTYVFAIVYAAADGTLETSPDVVMALLPKKEEKHPEIFVNFMEPCYGSCTE
RQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDS
LPMGVVVDYTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFYMINQNPGVKSLIKTPERL
SLEGERQPKSPGSTPTTPTSSQAPQKLDASAAAAPASLPPSSPAAPIATFSLLPAGGAPT
VFSFGSSSLKSSATVTGEPPSYSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVA
PSAASFSFGSSGFKPTLESTPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPV
SSSQSAPPMSPFSSASKPAASGPLSHPTPLSAPPSSVPLKSSVLPSPSGRSAQGSSSPVP
SMVQKSPRITPPAAKPGSPQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEEL
KARTSKACFQVGTSEEMKMLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVE
EAREQNERNRDSGYLHLLYKRPLDPKSEAQLQEIRRLHQYVKFAVQDVNDVLDLEWDQHL
EQKKKQRHLLVPERETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAV
PSQSSIHSFDSDLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVR
STAPASLSRSAFLSQRYYEDLDEVSSTSSVSQSLESEDARTSCKDDEAVVQAPRHAPVVR
TPSIQPSLLPHAAPFAKSHLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAP
SPSHPISAPQAAAAAALRRQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMG
SSVPYSTAKTPHPVLTPVAANQAKQGSLINSLKPSGPTPASGQLSSGDKASGTAKIETAV
TSTPSASGQFSKPFSFSPSGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGG
SKPSYEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGEL
LFPSSLAGETLGSFSGLRVGQADDSTKPTNKASSTSLTSTQPTKTSGVPSGFNFTAPPVL
GKHTEPPVTSSATTTSVAPPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFS
FGSQQTNSTVPPSAPPPTTAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSA
LPEKPGDSEVSASAASLLEEQQSAQLPQAPPQTSDSVKKEPVLAQPAVSNSGTAASSTSL
VALSAEATPATTGVPDARTEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASST
TSIVAPGPSAEAAAFGTVTSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAAS
TAPSLFGQQTGSTASTAAATPQVSSSGFSSPAFGTTAPGVFGQTTFGQASVFGQSASSAA
SVFSFSQPGFSSVPAFGQPASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQ
SNAPAFGQSPGFGQGGSVFGGTSAATTTAATSGFSFCQASGFGSSNTGSVFGQAASTGGI
VFGQQSSSSSGSVFGSGNTGRGGGFFSGLGGKPSQDAANKNPFSSASGGFGSTATSNTSN
LFGNSGAKTFGGFASSSFGEQKPTGTFSSGGGSVASQGFGFSSPNKTGGFGAAPVFGSPP
TFGGSPGFGGVPAFGSAPAFTSPLGSTGGKVFGEGTAAASAGGFGFGSSSNTTSFGTLAS
QNAPTFGSLSQQTSGFGTQSSGFSGFGSGTGGFSFGSNNSSVQGFGGWRS
NT seq 6273 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgagatggatgccatgattcccgagcgggagatgaaggattttcagtttaga
gcgctaaagaaggtgagaatctttgactcccctgaggaattgcccaaggaacgctcgagt
ctgcttgctgtgtccaacaaatatggtctggtcttcgctggtggagccagtggcttgcag
atttttcctactaaaaatcttcttattcaaaataaacccggagatgatcccaacaaaata
gttgataaagtccaaggcttgctagttcctatgaaattcccaatccatcacctggccttg
agctgtgataacctcacactctctgcgtgcatgatgtccagtgaatatggttccattatt
gctttttttgatgttcgcacattctcaaatgaggctaaacagcaaaaacgcccatttgcc
tatcataagcttttgaaagatgcaggaggcatggtgattgatatgaagtggaaccccact
gtcccctccatggtggcagtttgtctggctgatggtagtattgctgtcctgcaagtcacg
gaaacagtgaaagtatgtgcaactcttccttccacggtagcagtaacctctgtgtgctgg
agccccaaaggaaagcagctggcagtgggaaaacagaatggaactgtggtccagtatctt
cctactttgcaggaaaaaaaagtcattccttgtcctccgttttatgagtcagatcatcct
gtcagagttctggatgtgctgtggattggtacctacgtcttcgccatagtgtatgctgct
gcagatgggaccctggaaacgtctccagatgtggtgatggctctactaccgaaaaaagaa
gaaaagcacccagagatatttgtgaactttatggagccctgttatggcagctgcacggag
agacagcatcattactacctcagttacattgaggaatgggatttagtgctggcagcatct
gcggcttcaacagaagttagtatccttgctcgacaaagtgatcagattaattgggaatct
tggctactggaggattctagtcgagctgaattgcctgtgacagacaagagtgatgactcc
ttgcccatgggagttgtcgtagactatacaaaccaagtggaaatcaccatcagtgatgaa
aagactcttcctcctgctccagttctcatgttactttcaacagatggtgtgctttgtcca
ttttatatgattaatcaaaatcctggggttaagtctctcatcaaaacaccagagcgactt
tcattagaaggagagcgacagcccaagtcaccaggaagtactcccactaccccaacctcc
tctcaagccccacagaaactggatgcttctgcagctgcagcccctgcctctctgccacct
tcatcacctgctgctcccattgccactttttctttgcttcctgctggtggagcccccact
gtgttctcctttggttcttcatctttgaagtcatctgctacggtcactggggagccccct
tcatattccagtggctccgacagctccaaagcagccccaggccctggcccatcaaccttc
tcttttgttcccccttctaaagcctccctagcccccacccctgcagcgtctcctgtggct
ccatcagctgcttcattctcctttggatcatctggttttaagcctaccctggaaagcaca
ccagtgccaagtgtgtctgctccaaatatagcaatgaagccctccttcccaccctcaacc
tctgctgtcaaagtcaaccttagtgaaaagtttactgctgcagctacctctactcctgtt
agtagctcccagagcgcacccccgatgtcgccattctcttctgcctccaagccagctgct
tctggaccactcagccaccccacacctctctcagcaccacctagttccgtgccattgaag
tcctcagtcttgccctcaccatcaggacgatctgctcagggcagttcaagcccagtgccc
tcaatggtacagaaatcacccaggataacccctccagcggcaaagccaggctctccccag
gcaaagtcacttcagcctgctgttgcagaaaagcagggacatcagtggaaagattcagat
cctgtaatggctggaattggggaggagattgcacactttcagaaggagttggaagagtta
aaagcccgaacttccaaagcctgtttccaagtgggcacttctgaggagatgaagatgctg
cgaacagaatcagatgacttgcatacctttcttttggagattaaagagaccacagagtcg
cttcatggagatataagtagcctgaaaacaactttacttgagggctttgctggtgttgag
gaagccagagaacaaaatgaaagaaatcgtgactctggttatctgcatttgctttataaa
agaccactggatcccaagagtgaagctcagcttcaggaaattcggcgccttcatcagtat
gtgaaatttgctgtccaagatgtgaatgatgttctagacttggagtgggatcagcatctg
gaacaaaagaaaaaacaaaggcacctgcttgtgccagagcgagagacactgtttaacacc
ctagccaacaatcgggaaatcatcaaccaacagaggaagaggctgaatcacctggtggat
agtcttcagcagctccgcctttacaaacagacttccctgtggagcctgtcctcggctgtt
ccttcccagagcagcattcacagttttgacagtgacctggaaagcctgtgcaatgctttg
ttgaaaaccaccatagaatctcacaccaaatccttgcccaaagtaccagccaaactgtcc
cccatgaaacaggcacaactgagaaacttcttggccaagaggaagaccccaccagtgaga
tccactgctccagccagcctgtctcgatcagcctttctgtctcagagatattatgaagac
ttggatgaagtcagctcaacgtcatctgtctcccagtctctggagagtgaagatgcacgg
acgtcctgtaaagatgacgaggcagtggttcaggcccctcggcacgcccccgtggttcgc
actccttccatccagcccagtctcttgccccatgcagcaccttttgctaaatctcacctg
gttcatggttcttcacctggtgtgatgggaacttcagtggctacatctgctagcaaaatt
attcctcaaggggccgatagcacaatgcttgccacgaaaaccgtgaaacatggtgcacct
agtccttcccaccccatctcagccccgcaggcagctgccgcagcagcactcaggcggcag
atggccagtcaggcaccagctgtaaacactttgactgaatcaacgttgaagaatgtccct
caagtggtaaatgtgcaggaattgaagaataaccctgcaaccccttctacagccatgggt
tcttcagtgccctactccacagccaaaacacctcacccagtgttgaccccagtggctgct
aaccaagccaagcaggggtctctaataaattcccttaagccatctgggcctacaccagca
tccggtcagttatcatctggtgacaaagcttcagggacagccaagatagaaacagctgtg
acttcaaccccatctgcttctgggcagttcagcaagcctttctcattttctccatcaggg
actggctttaattttgggataatcacaccaacaccgtcttctaatttcactgctgcacaa
ggggcaacaccctccactaaagagtcaagccagccggacgcattctcatctggtggggga
agcaaaccttcttatgaggccattcctgaaagctcacctccctcaggaatcacatccgca
tcaaacaccaccccaggagaacctgccgcatctagcagcagacctgtggcaccttctgga
actgctctttccaccacctctagtaagctggaaaccccaccgtccaagctgggagagctt
ctgtttccaagttctttggctggagagactctgggaagtttttcaggactgcgggttggc
caagcagatgattctacaaaaccaaccaataaggcttcatccacaagcctaactagtacc
cagccaaccaagacgtcaggcgtgccctcagggtttaattttactgcccccccggtgtta
gggaagcacacggagccccctgtgacatcctctgcaaccaccacctcagtagcaccacca
gcagccaccagcacttcctcaactgccgtttttggcagtctgccagtcaccagtgcagga
tcctctggggtcatcagttttggtgggacatctctaagtgctggcaagactagtttttca
tttggaagccaacagaccaatagcacagtgcccccatctgccccaccaccaactacagct
gccactccccttccaacatcattccccacattgtcatttggtagcctcctgagttcagca
actaccccctccctgcctatgtccgctggcagaagcacagaagaggccacttcatcagct
ttgcctgagaagccaggtgacagtgaggtctcagcatcagcagcctcacttctagaggag
caacagtcagcccagcttccccaggctcctccgcaaacttctgactctgttaaaaaagaa
cctgttcttgcccagcctgcagtcagcaactctggcactgcagcatctagtactagtctt
gtagcactttctgcagaggctaccccagccaccacgggggtccctgatgccaggacggag
gcagtaccacctgcttcctccttttctgtgcctgggcagactgctgtcacagcagctgct
atctcaagtgcaggccctgtggccgtcgaaacatcaagtacccccatagcctccagcacc
acgtccattgttgctcccggcccatctgcagaggcagcagcatttggtaccgtcacttct
ggctcatccgtctttgctcagcctcctgctgccagttctagctcagctttcaaccagctc
accaacaacacagccactgccccctctgccacgcccgtgtttgggcaagtggcagccagc
accgcaccaagtctgtttgggcagcagactggtagcacagccagcacagcagctgccaca
ccacaggtcagcagctcagggtttagcagcccagcttttggtaccacagccccaggggtc
tttggacagacaaccttcgggcaggcctcagtctttgggcagtcggcgagcagtgctgca
agtgtcttttccttcagtcagcctgggttcagttccgtgcctgccttcggtcagcctgct
tcctccactcccacatccaccagtggaagtgtctttggtgccgcctcaagtaccagtagc
tccagttccttctcatttggacagtcttctcccaacacaggaggggggctgtttggccaa
agcaacgctcctgcttttgggcagagtcctggctttggacagggaggctctgtctttggt
ggtacctcagctgccaccacaacagcagcaacctctgggttcagcttttgccaagcttca
ggttttgggtctagtaatactggttctgtgtttggtcaagcagccagtactggtggaata
gtctttggccagcaatcatcctcttccagtggtagcgtgtttgggtctggaaacactgga
agagggggaggtttcttcagtggccttggaggaaaacccagtcaggatgcagccaacaaa
aacccattcagctcggccagtgggggctttggatccacagctacctcaaatacctctaac
ctatttggaaacagtggggccaagacatttggtggatttgccagctcgtcgtttggagag
cagaaacccactggcactttcagctctggaggaggaagtgtggcatcccaaggctttggg
ttttcctctccaaacaaaacaggtggcttcggtgctgctccagtgtttggcagccctcct
acttttgggggatcccctgggtttggaggggtgccagcattcggttcagccccagccttt
acaagccctctgggctcgacgggaggcaaagtgttcggagagggcactgcagctgccagc
gcaggaggattcgggtttgggagcagcagcaacaccacatccttcggcacgctcgcgagt
cagaatgcccccactttcggatcactgtcccaacagacttctggttttgggacccagagt
agcggattctctggttttggatcaggcacaggagggttcagctttgggtcaaataactcg
tctgtccagggttttggtggctggcgaagctga

DBGET integrated database retrieval system