KEGG   Homo sapiens (human): 80228Help
Entry
80228             CDS       T01001                                 

Gene name
ORAI2, C7orf19, CBCIP2, MEM142B, TMEM142B
Definition
ORAI calcium release-activated calcium modulator 2
Orthology
K16057  
calcium release-activated calcium channel protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    80228 (ORAI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
7q22.1
AA seq 254 aa AA seqDB search
MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSRAKL
KASSRTSALLSGFAMVAMVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALLISTCILP
NVEAVSNIHNLNSISESPHERMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARR
QPGPPPGPGSHTGWQAALVSTIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIEELHKL
KVQLDGHERSLQVL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgagcttaacgtgcctatcgacccctctgctcctgcctgccctgagcccggc
cataagggcatggattaccgggactgggtccgccgcagctacctggaactggtcacctct
aaccaccactcggtacaggccctgtcgtggcggaagctctacctgagcagggccaagctg
aaggcctccagcaggacctccgccctcctctccggctttgccatggtggccatggtggag
gtgcagctggagacgcagtaccagtacccgcggccgctgctgattgccttcagcgcctgc
accacggtgctggtggccgtgcacctgttcgccctcctcatcagcacctgcatcctgccc
aatgtggaggccgtgagcaacatccacaacctgaactccatcagcgagtccccgcatgag
cgcatgcacccctacatcgagctggcctggggcttctccaccgtgcttggcatcctactc
ttcctggccgaggtggtgctgctctgctggatcaagttcctccccgtggatgcccggcgc
cagcctggccccccacctggccctgggagtcacacgggctggcaggccgccctggtgtcc
accatcatcatggtgcccgtgggcctcatcttcgtggtcttcaccatccacttctaccgc
tccctggtgcgccacaaaacggagcgccacaaccgcgagatcgaggagctccacaagctc
aaggtccagctggacgggcatgagcgcagcctgcaggtcttgtga

DBGET integrated database retrieval system