KEGG   Homo sapiens (human): 80232Help
Entry
80232             CDS       T01001                                 

Gene name
WDR26, CDW2, GID7, MIP2
Definition
(RefSeq) WD repeat domain 26
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q42.13
AA seq 661 aa AA seqDB search
MQANGAGGGGGGGGGGGGGGGGGGGQGQTPELACLSAQNGESSPSSSSSAGDLAHANGLL
PSAPSAASNNSNSLNVNNGVPGGAAAASSATVAAASATTAASSSLATPELGSSLKKKKRL
SQSDEDVIRLIGQHLNGLGLNQTVDLLMQESGCRLEHPSATKFRNHVMEGDWDKAENDLN
ELKPLVHSPHAIVVRGALEISQTLLGIIVRMKFLLLQQKYLEYLEDGKVLEALQVLRCEL
TPLKYNTERIHVLSGYLMCSHAEDLRAKAEWEGKGTASRSKLLDKLQTYLPPSVMLPPRR
LQTLLRQAVELQRDRCLYHNTKLDNNLDSVSLLIDHVCSRRQFPCYTQQILTEHCNEVWF
CKFSNDGTKLATGSKDTTVIIWQVDPDTHLLKLLKTLEGHAYGVSYIAWSPDDNYLVACG
PDDCSELWLWNVQTGELRTKMSQSHEDSLTSVAWNPDGKRFVTGGQRGQFYQCDLDGNLL
DSWEGVRVQCLWCLSDGKTVLASDTHQRIRGYNFEDLTDRNIVQEDHPIMSFTISKNGRL
ALLNVATQGVHLWDLQDRVLVRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHK
RSELPIAELTGHTRTVNCVSWNPQIPSMMASASDDGTVRIWGPAPFIDHQNIEEECSSMD
S
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccaatggggcaggaggaggaggaggaggtggcggcggcggcggtggaggagga
gggggcggcgggggccagggacagaccccggaactcgcctgcttgtcggcccagaacggg
gagtcgtccccctcgtcgtcgtcgtccgcgggggacctggcccacgccaatgggctcctg
ccttccgccccctccgccgccagcaacaatagcaacagcctgaatgtcaataacggggtt
cccggcggggcggccgccgcatcctcagccaccgtcgcagctgcctccgccaccaccgcc
gcctcctcttccttggccaccccagaactgggcagcagcctcaagaagaagaagcggctc
tcccagtcagatgaggatgtcattaggctaataggacagcacttgaatggcttagggctc
aaccagactgttgatctcctcatgcaagagtcaggatgtcgtttagaacatccttctgct
accaaattccgaaatcatgtcatggaaggagactgggataaggcagaaaatgacctgaat
gaactaaagcctttagtgcattctcctcatgctattgtggtaagaggcgcacttgaaatc
tctcaaacgttgttgggaataattgtgaggatgaagtttttgctgctgcagcagaagtac
ctagaatacctggaggatggcaaggtcctggaggcacttcaagttctacgctgtgaattg
acgccgctgaaatacaatacagagcgcattcatgttcttagtgggtatctgatgtgtagc
catgcagaagacctacgtgcaaaagcagaatgggaaggcaaagggacagcttcccgatct
aaactattggataaacttcagacctatttaccaccatcagtgatgcttcccccacggcgt
ttacagactctcctgcggcaggcggtggaactacaaagggatcggtgcctatatcacaat
accaaacttgataataatctagattctgtgtctctgcttatagaccatgtttgtagtagg
aggcagttcccatgttatacgcagcagatacttacggagcattgtaatgaagtgtggttc
tgtaaattctctaatgatggcactaaactagcaacaggatcaaaagatacaacagttatc
atatggcaagttgatccggatacacacctgctaaaactgcttaaaacattagaaggacat
gcttatggcgtttcttatattgcatggagtccagatgacaactatcttgttgcttgtggc
ccagatgactgctctgagctttggctttggaatgtacaaacaggagaactaaggacaaaa
atgagccagtctcatgaagacagtttgacaagtgtggcttggaatccagatgggaagcgc
tttgtgactggaggtcagcgtgggcagttctatcagtgtgacttagatggtaatctcctt
gactcctgggaaggggtaagagtgcaatgcctttggtgcttgagtgatggaaagactgtt
ctggcatcagatacacaccagcgaattcggggctataacttcgaggaccttacagatagg
aacatagtacaagaagatcatcctattatgtcttttactatttcaaaaaatggccgatta
gctttgttaaatgtagcaactcagggagttcatttatgggacttgcaagacagagtttta
gtaagaaagtatcaaggtgttacacaagggttttatacaattcattcatgttttggaggc
cataatgaagacttcatcgctagtggcagtgaagatcacaaggtttacatctggcacaaa
cgtagtgaactgccaattgcggagctgacagggcacacacgtacagtaaactgtgtgagc
tggaacccacagattccatccatgatggccagcgcctcagatgatggcactgttagaata
tggggaccagcaccttttatagaccaccagaatattgaagaggaatgcagtagcatggat
agttga

DBGET integrated database retrieval system