KEGG   Homo sapiens (human): 8027Help
Entry
8027              CDS       T01001                                 

Gene name
STAM, STAM-1, STAM1
Definition
signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
Orthology
K04705  
signal transducing adaptor molecule
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Jak-STAT signaling pathway
Module
ESCRT-0 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    8027 (STAM)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    8027 (STAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10p14-p13
AA seq 540 aa AA seqDB search
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAI
ELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA
QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVY
SPPPAATAAAATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcctctttttgccaccaatcccttcgatcaggatgttgagaaagcaaccagcgagatg
aatactgctgaggactggggcctcattttggatatctgtgataaagttggtcagtctcgc
actggacctaaggattgtcttcggtctattatgagaagagtgaaccacaaagatcctcac
gttgctatgcaggctttgactcttctaggagcatgtgtatcaaactgtggcaaaattttt
catttagaagtatgttcaagagattttgctagtgaagtaagcaacgtattaaataagggt
catcctaaagtatgtgaaaaattaaaggctcttatggttgaatggacagatgaatttaag
aatgatccacagcttagtctaatatcagcaatgattaagaaccttaaggaacaaggagtt
acgttcccagctattggctctcaggctgcagaacaagcaaaagcaagcccagctcttgta
gccaaggatcctggtactgtggctaacaaaaaagaagaagaagatttagcaaaagccatt
gagttgtctctcaaggaacaaaggcagcagtcaaccaccctttccactttgtatccaagc
acatccagtctcttaactaaccaccaacatgaaggccgaaaagttcgtgctatatatgac
tttgaagctgctgaagacaatgaacttacttttaaagctggagaaattattacagttctt
gatgacagtgatcctaactggtggaaaggtgaaacccatcaaggcatagggttatttcct
tctaattttgtgactgcagatctcactgctgaaccagaaatgattaaaacagagaagaag
acggtacaatttagtgatgatgttcaggtagagacaatagaaccagagccggaaccagcc
tttattgatgaagataaaatggaccagttgctacagatgctgcaaagtacagaccccagt
gatgatcagccagacctaccagagctgcttcatcttgaagcaatgtgtcaccagatggga
cctctcattgatgaaaagctggaagatattgatagaaaacattcagaactctcagaactt
aatgtgaaagtgatggaggccctttccttatataccaagttaatgaacgaagatccgatg
tattccatgtatgcaaagttacagaatcagccatattatatgcagtcatctggtgtttct
ggttctcaggtgtatgcagggcctcctccaagtggtgcctacctggttgcagggaacgcg
cagatgagccacctccagagctacagtcttcccccggagcagctgtcttctctcagccag
gcagtggtcccaccatccgcaaacccagcccttcctagtcagcagactcaggccgcttac
ccaaatacaatggtcagttccgttcaaggaaacacatatcccagccaggcgccagtatat
agtcctcctcctgccgctactgctgctgctgcaactgccgatgtcactctgtaccagaat
gcaggacctaatatgccccaggtgccaaactataacttaacatcatcaactctgcctcag
cccggaggcagccaacagccacctcagccacagcaaccatattctcagaaggctctgcta
tag

DBGET integrated database retrieval system