KEGG   Homo sapiens (human): 8027Help
Entry
8027              CDS       T01001                                 

Gene name
STAM, STAM-1, STAM1
Definition
(RefSeq) signal transducing adaptor molecule
  KO
K04705  signal transducing adaptor molecule
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04630  Jak-STAT signaling pathway
Module
hsa_M00408  ESCRT-0 complex
Network
N00183  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    8027 (STAM)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    8027 (STAM)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    8027 (STAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VHS SH3_1 SH3_2 SH3_9 UIM GAT
Motif
Other DBs
NCBI-GeneID: 8027
NCBI-ProteinID: NP_003464
OMIM: 601899
HGNC: 11357
Ensembl: ENSG00000136738
Vega: OTTHUMG00000017749
Pharos: Q92783(Tbio)
UniProt: Q92783
Structure
PDB: 

Jmol
Position
10p12.33
AA seq 540 aa AA seqDB search
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAI
ELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA
QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVY
SPPPAATAAAATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcctctttttgccaccaatcccttcgatcaggatgttgagaaagcaaccagcgagatg
aatactgctgaggactggggcctcattttggatatctgtgataaagttggtcagtctcgc
actggacctaaggattgtcttcggtctattatgagaagagtgaaccacaaagatcctcac
gttgctatgcaggctttgactcttctaggagcatgtgtatcaaactgtggcaaaattttt
catttagaagtatgttcaagagattttgctagtgaagtaagcaacgtattaaataagggt
catcctaaagtatgtgaaaaattaaaggctcttatggttgaatggacagatgaatttaag
aatgatccacagcttagtctaatatcagcaatgattaagaaccttaaggaacaaggagtt
acgttcccagctattggctctcaggctgcagaacaagcaaaagcaagcccagctcttgta
gccaaggatcctggtactgtggctaacaaaaaagaagaagaagatttagcaaaagccatt
gagttgtctctcaaggaacaaaggcagcagtcaaccaccctttccactttgtatccaagc
acatccagtctcttaactaaccaccaacatgaaggccgaaaagttcgtgctatatatgac
tttgaagctgctgaagacaatgaacttacttttaaagctggagaaattattacagttctt
gatgacagtgatcctaactggtggaaaggtgaaacccatcaaggcatagggttatttcct
tctaattttgtgactgcagatctcactgctgaaccagaaatgattaaaacagagaagaag
acggtacaatttagtgatgatgttcaggtagagacaatagaaccagagccggaaccagcc
tttattgatgaagataaaatggaccagttgctacagatgctgcaaagtacagaccccagt
gatgatcagccagacctaccagagctgcttcatcttgaagcaatgtgtcaccagatggga
cctctcattgatgaaaagctggaagatattgatagaaaacattcagaactctcagaactt
aatgtgaaagtgatggaggccctttccttatataccaagttaatgaacgaagatccgatg
tattccatgtatgcaaagttacagaatcagccatattatatgcagtcatctggtgtttct
ggttctcaggtgtatgcagggcctcctccaagtggtgcctacctggttgcagggaacgcg
cagatgagccacctccagagctacagtcttcccccggagcagctgtcttctctcagccag
gcagtggtcccaccatccgcaaacccagcccttcctagtcagcagactcaggccgcttac
ccaaatacaatggtcagttccgttcaaggaaacacatatcccagccaggcgccagtatat
agtcctcctcctgccgctactgctgctgctgcaactgccgatgtcactctgtaccagaat
gcaggacctaatatgccccaggtgccaaactataacttaacatcatcaactctgcctcag
cccggaggcagccaacagccacctcagccacagcaaccatattctcagaaggctctgcta
tag

DBGET integrated database retrieval system