KEGG   Homo sapiens (human): 8030Help
Entry
8030              CDS       T01001                                 

Gene name
CCDC6, D10S170, H4, PTC, TPC, TST1
Definition
(RefSeq) coiled-coil domain containing 6
  KO
K09288  coiled-coil domain-containing protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05216  Thyroid cancer
Disease
H00032  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8030 (CCDC6)
   05216 Thyroid cancer
    8030 (CCDC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2046
Motif
Other DBs
NCBI-GeneID: 8030
NCBI-ProteinID: NP_005427
OMIM: 601985
HGNC: 18782
Ensembl: ENSG00000108091
Vega: OTTHUMG00000018284
Pharos: Q16204(Tbio)
UniProt: Q16204 Q05CP8
Position
10q21.2
AA seq 474 aa AA seqDB search
MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGGGGGGGGKSGGIVISPFRLEELT
NRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKI
QALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKK
LENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVS
APPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREE
NLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSP
SSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSP
DKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSAHPSSQP
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcggacagcgccagcgagagcgacacggacggggcggggggcaacagcagcagctcg
gccgccatgcagtcgtcctgctcgtcgacctcgggcggcggcggtggcggcgggggaggc
ggcggcggtgggaagtcggggggcattgtcatctcgccgttccgcctggaggagctcacc
aaccgcctggcctcgctgcagcaagagaacaaggtgctgaagatagagctggagacctac
aaactgaagtgcaaggcactgcaggaggagaaccgcgacctgcgcaaagccagcgtgacc
atccaagccagggctgagcaggaagaagaattcattagtaacactttattcaagaaaatt
caggctttgcagaaggagaaagaaacccttgctgtaaattatgagaaagaagaagaattc
ctcactaatgagctctccagaaaattgatgcagttgcagcatgagaaagccgaactagaa
cagcatcttgaacaagagcaggaatttcaggtcaacaaactgatgaagaaaattaaaaaa
ctggagaatgacaccatttctaagcaacttacattagaacagttgagacgggagaagatt
gaccttgaaaatacattggaacaagaacaagaagcactagttaatcgcctctggaaaagg
atggataagcttgaagctgaaaagcgaatcctgcaggaaaaattagaccagcccgtctct
gctccaccatcgcctagagatatctccatggagattgattctccagaaaatatgatgcgt
cacatcaggtttttaaagaatgaagtggaacggctgaagaagcaactgagagctgctcag
ttacagcattcagagaaaatggcacagtatctggaggaggaacgtcacatgagagaagag
aacttgaggctccagaggaagctgcagagggagatggagagaagagaagccctctgtcga
cagctctccgagagtgagtccagcttagaaatggacgacgaaaggtattttaatgagatg
tctgcacaaggattaagacctcgcactgtgtccagcccgatcccttacacaccttctccg
agttcaagcaggcctatatcacctggtctatcatatgcaagtcacacggttggtttcacg
ccaccaacttcactgactagagctggaatgtcttattacaattccccgggtcttcacgtg
cagcacatgggaacatcccatggtatcacaaggccttcaccacggagaagcaacagtcct
gacaaattcaaacggcccacgccgcctccatctcccaacacacagaccccagtccagcca
cctccgcctccacctccgccacccatgcagcccacggtcccctcagcagccacctcgcag
cctactccttcgcaacattcggcgcacccctcctcccagccttaa

DBGET integrated database retrieval system