KEGG   Homo sapiens (human): 8030Help
Entry
8030              CDS       T01001                                 

Gene name
CCDC6, D10S170, H4, PTC, TPC, TST1
Definition
coiled-coil domain containing 6
Orthology
K09288  
coiled-coil domain-containing protein 6
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Thyroid cancer
Disease
H00032  
Thyroid cancer
Class
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Thyroid cancer [PATH:hsa05216]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q21
AA seq 474 aa AA seqDB search
MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGGGGGGGGKSGGIVISPFRLEELT
NRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKI
QALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKK
LENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVS
APPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREE
NLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSP
SSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSP
DKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSAHPSSQP
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcggacagcgccagcgagagcgacacggacggggcggggggcaacagcagcagctcg
gccgccatgcagtcgtcctgctcgtcgacctcgggcggcggcggtggcggcgggggaggc
ggcggcggtgggaagtcggggggcattgtcatctcgccgttccgcctggaggagctcacc
aaccgcctggcctcgctgcagcaagagaacaaggtgctgaagatagagctggagacctac
aaactgaagtgcaaggcactgcaggaggagaaccgcgacctgcgcaaagccagcgtgacc
atccaagccagggctgagcaggaagaagaattcattagtaacactttattcaagaaaatt
caggctttgcagaaggagaaagaaacccttgctgtaaattatgagaaagaagaagaattc
ctcactaatgagctctccagaaaattgatgcagttgcagcatgagaaagccgaactagaa
cagcatcttgaacaagagcaggaatttcaggtcaacaaactgatgaagaaaattaaaaaa
ctggagaatgacaccatttctaagcaacttacattagaacagttgagacgggagaagatt
gaccttgaaaatacattggaacaagaacaagaagcactagttaatcgcctctggaaaagg
atggataagcttgaagctgaaaagcgaatcctgcaggaaaaattagaccagcccgtctct
gctccaccatcgcctagagatatctccatggagattgattctccagaaaatatgatgcgt
cacatcaggtttttaaagaatgaagtggaacggctgaagaagcaactgagagctgctcag
ttacagcattcagagaaaatggcacagtatctggaggaggaacgtcacatgagagaagag
aacttgaggctccagaggaagctgcagagggagatggagagaagagaagccctctgtcga
cagctctccgagagtgagtccagcttagaaatggacgacgaaaggtattttaatgagatg
tctgcacaaggattaagacctcgcactgtgtccagcccgatcccttacacaccttctccg
agttcaagcaggcctatatcacctggtctatcatatgcaagtcacacggttggtttcacg
ccaccaacttcactgactagagctggaatgtcttattacaattccccgggtcttcacgtg
cagcacatgggaacatcccatggtatcacaaggccttcaccacggagaagcaacagtcct
gacaaattcaaacggcccacgccgcctccatctcccaacacacagaccccagtccagcca
cctccgcctccacctccgccacccatgcagcccacggtcccctcagcagccacctcgcag
cctactccttcgcaacattcggcgcacccctcctcccagccttaa

DBGET integrated database retrieval system