KEGG   Homo sapiens (human): 80301Help
Entry
80301             CDS       T01001                                 

Gene name
PLEKHO2, PLEKHQ1, PP1628, pp9099
Definition
pleckstrin homology domain containing, family O member 2
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    80301 (PLEKHO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q22.1
AA seq 440 aa AA seqDB search
MEEEDDQKCVETVELGSYEKCQDLRALLKRKHRFILLRSPGNKVSDIKFQAPTGEEKESW
IKALNEGINRGKNKAFDEVKVDKSCALEHVTRDRVRGGQRRRPPTRVHLKEVASAASDGL
LRLDLDVPDSGPPVFAPSNHVSEAQPRETPRPLMPPTKPFLAPETTSPGDRVETPVGERA
PTPVSASSEVSPESQEDSETPAEEDSGSEQPPNSVLPDKLKVSWENPSPQEAPAAESAEP
SQAPCSETSEAAPREGGKPPTPPPKILSEKLKASMGEMQASGPPAPGTVQVSVNGMDDSP
EPAKPSQAEGTPGTPPKDATTSTALPPWDLPPQFHPRCSSLGDLLGEGPRHPLQPRERLY
RAQLEVKVASEQTEKLLNKVLGSEPAPVSAETLLSQAVEQLRQATQVLQEMRDLGELSQE
APGLREKRKELVTLYRRSAP
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggaggatgatcagaagtgtgtggagactgtggagctgggcagctatgagaag
tgccaggaccttcgtgccctcctcaagcgaaaacaccgctttatcctgctgcgatcccca
gggaacaaggtcagcgacatcaaattccaggcacccaccggggaggagaaggaatcctgg
atcaaagccctcaatgaagggattaaccgaggcaaaaacaaggctttcgatgaggtaaag
gtggacaagagctgcgccctggagcatgtgacacgggaccgggtgcgagggggccagcga
cgccggccaccaacgagagtccacctgaaggaggtggccagtgcagcttctgacggtctt
ctgcgcctggatcttgatgttccggacagtgggccaccagtgtttgcccccagcaatcat
gtcagtgaagcccaacctcgggagacaccccggcccctcatgcctcctaccaagcctttc
ctagcacctgagaccaccagccctggtgacagggtggagacccctgtgggggagagagcc
ccaacccctgtctcagcaagctctgaggtctcccctgagagccaagaggactcagagacc
ccagcagaggaggacagtggctctgagcagcctcccaacagcgtcctgcctgacaaactg
aaggtgagctgggagaaccccagcccccaggaggcccctgctgcagagagtgcagaaccg
tcccaggcaccctgttctgagacttctgaggctgcccccagggagggtgggaagccccct
acacccccacccaagatcttatcagagaaactgaaagcctccatgggtgagatgcaggct
tctgggccacctgctccaggcacagtgcaggtctcagtgaatggcatggatgacagtcct
gagcctgccaagccctctcaggctgagggcaccccaggaactcctccaaaggatgcaaca
acatccacagcactgcccccctgggacctgccacctcagttccatccccgctgctcctcc
cttggggacttgcttggggaaggcccgcggcatcccttgcagcccagggaacggctatat
cgggcccagctggaggtgaaggtggcctcggaacagacggagaaactgttgaacaaggtg
ctgggcagtgagccggcccctgttagtgccgaaacattgctcagccaggctgtggagcag
ctgaggcaggccacccaggtcctgcaggaaatgagagatttgggagagctgagccaggaa
gcacctgggctaagggagaagcggaaggagctggtgaccctctacaggagaagtgcaccc
tag

DBGET integrated database retrieval system