KEGG   Homo sapiens (human): 80301Help
Entry
80301             CDS       T01001                                 

Gene name
PLEKHO2, PLEKHQ1, PP1628, pp9099
Definition
(RefSeq) pleckstrin homology domain containing O2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    80301 (PLEKHO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH PH_11 PH_9
Motif
Other DBs
NCBI-GeneID: 80301
NCBI-ProteinID: NP_079477
HGNC: 30026
Ensembl: ENSG00000241839
Vega: OTTHUMG00000133050
Pharos: Q8TD55(Tdark)
UniProt: Q8TD55
Position
15q22.31
AA seq 490 aa AA seqDB search
MEEEGVKEAGEKPRGAQMVDKAGWIKKSSGGLLGFWKDRYLLLCQAQLLVYENEDDQKCV
ETVELGSYEKCQDLRALLKRKHRFILLRSPGNKVSDIKFQAPTGEEKESWIKALNEGINR
GKNKAFDEVKVDKSCALEHVTRDRVRGGQRRRPPTRVHLKEVASAASDGLLRLDLDVPDS
GPPVFAPSNHVSEAQPRETPRPLMPPTKPFLAPETTSPGDRVETPVGERAPTPVSASSEV
SPESQEDSETPAEEDSGSEQPPNSVLPDKLKVSWENPSPQEAPAAESAEPSQAPCSETSE
AAPREGGKPPTPPPKILSEKLKASMGEMQASGPPAPGTVQVSVNGMDDSPEPAKPSQAEG
TPGTPPKDATTSTALPPWDLPPQFHPRCSSLGDLLGEGPRHPLQPRERLYRAQLEVKVAS
EQTEKLLNKVLGSEPAPVSAETLLSQAVEQLRQATQVLQEMRDLGELSQEAPGLREKRKE
LVTLYRRSAP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggagggtgtgaaggaagccggtgagaagcctcggggagcacagatggtggac
aaggctggctggatcaagaagagcagtgggggcctcctgggtttctggaaagaccgatat
ctgctcctctgccaggcccagctgctggtctatgagaatgaggatgatcagaagtgtgtg
gagactgtggagctgggcagctatgagaagtgccaggaccttcgtgccctcctcaagcga
aaacaccgctttatcctgctgcgatccccagggaacaaggtcagcgacatcaaattccag
gcacccaccggggaggagaaggaatcctggatcaaagccctcaatgaagggattaaccga
ggcaaaaacaaggctttcgatgaggtaaaggtggacaagagctgcgccctggagcatgtg
acacgggaccgggtgcgagggggccagcgacgccggccaccaacgagagtccacctgaag
gaggtggccagtgcagcttctgacggtcttctgcgcctggatcttgatgttccggacagt
gggccaccagtgtttgcccccagcaatcatgtcagtgaagcccaacctcgggagacaccc
cggcccctcatgcctcctaccaagcctttcctagcacctgagaccaccagccctggtgac
agggtggagacccctgtgggggagagagccccaacccctgtctcagcaagctctgaggtc
tcccctgagagccaagaggactcagagaccccagcagaggaggacagtggctctgagcag
cctcccaacagcgtcctgcctgacaaactgaaggtgagctgggagaaccccagcccccag
gaggcccctgctgcagagagtgcagaaccgtcccaggcaccctgttctgagacttctgag
gctgcccccagggagggtgggaagccccctacacccccacccaagatcttatcagagaaa
ctgaaagcctccatgggtgagatgcaggcttctgggccacctgctccaggcacagtgcag
gtctcagtgaatggcatggatgacagtcctgagcctgccaagccctctcaggctgagggc
accccaggaactcctccaaaggatgcaacaacatccacagcactgcccccctgggacctg
ccacctcagttccatccccgctgctcctcccttggggacttgcttggggaaggcccgcgg
catcccttgcagcccagggaacggctatatcgggcccagctggaggtgaaggtggcctcg
gaacagacggagaaactgttgaacaaggtgctgggcagtgagccggcccctgttagtgcc
gaaacattgctcagccaggctgtggagcagctgaggcaggccacccaggtcctgcaggaa
atgagagatttgggagagctgagccaggaagcacctgggctaagggagaagcggaaggag
ctggtgaccctctacaggagaagtgcaccctag

DBGET integrated database retrieval system