KEGG   Homo sapiens (human): 80310Help
Entry
80310             CDS       T01001                                 

Gene name
PDGFD, IEGF, MSTP036, SCDGF-B, SCDGFB
Definition
(RefSeq) platelet derived growth factor D
  KO
K05450  platelet derived growth factor C/D
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04540  Gap junction
hsa04810  Regulation of actin cytoskeleton
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    80310 (PDGFD)
   04015 Rap1 signaling pathway
    80310 (PDGFD)
   04010 MAPK signaling pathway
    80310 (PDGFD)
   04072 Phospholipase D signaling pathway
    80310 (PDGFD)
   04151 PI3K-Akt signaling pathway
    80310 (PDGFD)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    80310 (PDGFD)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    80310 (PDGFD)
   04540 Gap junction
    80310 (PDGFD)
  Cell motility
   04810 Regulation of actin cytoskeleton
    80310 (PDGFD)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    80310 (PDGFD)
   05218 Melanoma
    80310 (PDGFD)
   05215 Prostate cancer
    80310 (PDGFD)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    80310 (PDGFD)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    80310 (PDGFD)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PDGFRA; platelet-derived growth factor receptor, alpha polypeptide [KO:K04363]
     80310 (PDGFD)
    PDGFRB; platelet-derived growth factor receptor, beta polypeptide [KO:K05089]
     80310 (PDGFD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUB PDGF
Motif
Other DBs
NCBI-GeneID: 80310
NCBI-ProteinID: NP_079484
OMIM: 609673
HGNC: 30620
Ensembl: ENSG00000170962
Vega: OTTHUMG00000165953
Pharos: Q9GZP0(Tbio)
UniProt: Q9GZP0
Position
11q22.3
AA seq 370 aa AA seqDB search
MHRLIFVYTLICANFCSCRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVKG
NGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDIS
ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASE
TNWESVTSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMY
LDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQ
RCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERC
DCICSSRPPR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcaccggctcatctttgtctacactctaatctgcgcaaacttttgcagctgtcgggac
acttctgcaaccccgcagagcgcatccatcaaagctttgcgcaacgccaacctcaggcga
gatgagagcaatcacctcacagacttgtaccgaagagatgagaccatccaggtgaaagga
aacggctacgtgcagagtcctagattcccgaacagctaccccaggaacctgctcctgaca
tggcggcttcactctcaggagaatacacggatacagctagtgtttgacaatcagtttgga
ttagaggaagcagaaaatgatatctgtaggtatgattttgtggaagttgaagatatatcc
gaaaccagtaccattattagaggacgatggtgtggacacaaggaagttcctccaaggata
aaatcaagaacgaaccaaattaaaatcacattcaagtccgatgactactttgtggctaaa
cctggattcaagatttattattctttgctggaagatttccaacccgcagcagcttcagag
accaactgggaatctgtcacaagctctatttcaggggtatcctataactctccatcagta
acggatcccactctgattgcggatgctctggacaaaaaaattgcagaatttgatacagtg
gaagatctgctcaagtacttcaatccagagtcatggcaagaagatcttgagaatatgtat
ctggacacccctcggtatcgaggcaggtcataccatgaccggaagtcaaaagttgacctg
gataggctcaatgatgatgccaagcgttacagttgcactcccaggaattactcggtcaat
ataagagaagagctgaagttggccaatgtggtcttctttccacgttgcctcctcgtgcag
cgctgtggaggaaattgtggctgtggaactgtcaactggaggtcctgcacatgcaattca
gggaaaaccgtgaaaaagtatcatgaggtattacagtttgagcctggccacatcaagagg
aggggtagagctaagaccatggctctagttgacatccagttggatcaccatgaacgatgt
gattgtatctgcagctcaagaccacctcgataa

DBGET integrated database retrieval system