KEGG   Homo sapiens (human): 80310Help
Entry
80310             CDS       T01001                                 

Gene name
PDGFD, IEGF, SCDGF-B, SCDGFB
Definition
platelet derived growth factor D
Orthology
K05450  
platelet derived growth factor C/D
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Prostate cancer
Melanoma
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    80310 (PDGFD)
   04015 Rap1 signaling pathway
    80310 (PDGFD)
   04151 PI3K-Akt signaling pathway
    80310 (PDGFD)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    80310 (PDGFD)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    80310 (PDGFD)
  Cellular commiunity
   04510 Focal adhesion
    80310 (PDGFD)
   04540 Gap junction
    80310 (PDGFD)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    80310 (PDGFD)
   05218 Melanoma
    80310 (PDGFD)
   05215 Prostate cancer
    80310 (PDGFD)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    80310 (PDGFD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q22.3
AA seq 370 aa AA seqDB search
MHRLIFVYTLICANFCSCRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVKG
NGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDIS
ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASE
TNWESVTSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMY
LDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQ
RCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERC
DCICSSRPPR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcaccggctcatctttgtctacactctaatctgcgcaaacttttgcagctgtcgggac
acttctgcaaccccgcagagcgcatccatcaaagctttgcgcaacgccaacctcaggcga
gatgagagcaatcacctcacagacttgtaccgaagagatgagaccatccaggtgaaagga
aacggctacgtgcagagtcctagattcccgaacagctaccccaggaacctgctcctgaca
tggcggcttcactctcaggagaatacacggatacagctagtgtttgacaatcagtttgga
ttagaggaagcagaaaatgatatctgtaggtatgattttgtggaagttgaagatatatcc
gaaaccagtaccattattagaggacgatggtgtggacacaaggaagttcctccaaggata
aaatcaagaacgaaccaaattaaaatcacattcaagtccgatgactactttgtggctaaa
cctggattcaagatttattattctttgctggaagatttccaacccgcagcagcttcagag
accaactgggaatctgtcacaagctctatttcaggggtatcctataactctccatcagta
acggatcccactctgattgcggatgctctggacaaaaaaattgcagaatttgatacagtg
gaagatctgctcaagtacttcaatccagagtcatggcaagaagatcttgagaatatgtat
ctggacacccctcggtatcgaggcaggtcataccatgaccggaagtcaaaagttgacctg
gataggctcaatgatgatgccaagcgttacagttgcactcccaggaattactcggtcaat
ataagagaagagctgaagttggccaatgtggtcttctttccacgttgcctcctcgtgcag
cgctgtggaggaaattgtggctgtggaactgtcaactggaggtcctgcacatgcaattca
gggaaaaccgtgaaaaagtatcatgaggtattacagtttgagcctggccacatcaagagg
aggggtagagctaagaccatggctctagttgacatccagttggatcaccatgaacgatgt
gattgtatctgcagctcaagaccacctcgataa

DBGET integrated database retrieval system