KEGG   Homo sapiens (human): 80311Help
Entry
80311             CDS       T01001                                 

Gene name
KLHL15, HEL-S-305
Definition
kelch-like family member 15
Orthology
K10452  
kelch-like protein 15
Organism
hsa  Homo sapiens (human)
Brite
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   Cul3 complex
    target recognizing subunit (BTB)
     80311 (KLHL15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp22.1-p21
AA seq 604 aa AA seqDB search
MAGDVEGFCSSIHDTSVSAGFRALYEEGLLLDVTLVIEDHQFQAHKALLATQSDYFRIMF
TADMRERDQDKIHLKGLTATGFSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKFC
CSFLLAKICLENCAEIMRLLDDFGVNIEGVREKLDTFLLDNFVPLMSRPDFLSYLSFEKL
MSYLDNDHLSRFPEIELYEAVQSWLRHDRRRWRHTDTIIQNIRFCLMTPTSVFEKVKTSE
FYRYSRQLRYEVDQALNYFQNVHQQPLLDMKSSRIRSAKPQTTVFRGMIGHSMVNSKILL
LKKPRVWWELEGPQVPLRPDCLAIVNNFVFLLGGEELGPDGEFHASSKVFRYDPRQNSWL
QMADMSVPRSEFAVGVIGKFIYAVAGRTRDETFYSTERYDITNDKWEFVDPYPVNKYGHE
GTVLNNKLFITGGITSSSTSKQVCVFDPSKEGTIEQRTRRTQVVTNCWENKSKMNYARCF
HKMISYNGKLYVFGGVCVILRASFESQGCPSTEVYNPETDQWTILASMPIGRSGHGVTVL
DKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVCNLHFPDYVLDEV
RRCN
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggacgtggaaggattctgttcctccatccacgacaccagtgtctctgctggg
ttcagagcactgtatgaggagggattgcttcttgatgtcactctggttattgaagatcat
cagttccaggcccataaagcactcttggccacccagagtgattacttcagaattatgttt
actgcagacatgagggaacgagatcaggacaaaattcatttaaaaggtctaacagctacc
ggtttcagccatgtcctgcaatttatgtactatggaactatagagctgagtatgaatacc
gttcatgagattcttcaggctgccatgtatgttcaacttatagaagtggtgaagttctgc
tgctcttttctcttagcgaagatctgcctagaaaattgtgcagaaattatgagactctta
gatgatttcggcgtaaacatcgagggagtcagggagaagttagacacctttctgctagac
aactttgtgccactcatgtctaggcctgactttctgtcctatctgagctttgagaagctc
atgtcttacttggataatgatcatctgagcaggttcccagagatagagctgtacgaggct
gtgcagtcttggctgcggcatgatagaagacgctggagacataccgataccatcattcag
aatatccggttttgcttgatgaccccaaccagcgtttttgagaaggttaagacatcagaa
ttttatagatactcccgacagctccgttacgaagttgaccaagcattgaattactttcag
aatgttcaccagcagcctttgttggatatgaagtcaagccgcatccgttctgcaaaaccg
caaactacagtatttcgaggaatgattggacatagcatggttaacagtaaaatacttctc
ttaaagaaaccaagagtctggtgggagctagaaggcccacaagtacctctgcgacctgac
tgccttgctatcgtcaataattttgtgttcctgttaggcggggaagagctgggcccggat
ggtgaattccatgcttcttccaaagtattcaggtatgacccgagacagaactcctggctg
cagatggcagatatgtctgtaccacgctctgaatttgctgtaggtgttattgggaagttt
atttacgccgtagcaggcagaaccagagatgagactttctattcaactgagagatatgac
atcaccaacgataaatgggaatttgtggatccttatccagttaacaaatatggacatgag
gggacagtgctcaataacaaattgtttatcaccggtggaatcacctcatcttccacctcc
aagcaagtgtgcgtgtttgaccccagcaaagaagggaccatagaacaacggaccaggaga
actcaagtggttaccaactgttgggagaataagagcaagatgaattacgcgagatgcttt
cacaagatgatttcttacaatggcaagctttatgtcttcggtggtgtctgtgtgatcttg
agggcctctttcgaatctcagggatgcccttctacagaagtatacaacccagagactgat
cagtggaccatcttggcatccatgccgattggtagaagtggccatggtgtgactgtgctg
gacaaacaaataatggttcttggaggcctttgttataatggtcattacagcgattccatc
ctcacttttgatccggatgaaaacaagtggaaggaagatgagtaccctcggatgccctgc
aagctggatggtttacaagtatgcaacctgcattttccggactatgtactggatgaggtc
aggcgttgcaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system