KEGG   Homo sapiens (human): 80311Help
Entry
80311             CDS       T01001                                 

Gene name
KLHL15, HEL-S-305
Definition
(RefSeq) kelch like family member 15
  KO
K10452  kelch-like protein 15
Organism
hsa  Homo sapiens (human)
Disease
H00480  Non-syndromic X-linked mental retardation
Brite
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     80311 (KLHL15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_1 Kelch_6 BTB Kelch_4 Kelch_3 BACK Kelch_2 Kelch_5
Motif
Other DBs
NCBI-GeneID: 80311
NCBI-ProteinID: NP_085127
OMIM: 300980
HGNC: 29347
Ensembl: ENSG00000174010
Vega: OTTHUMG00000021261
Pharos: Q96M94(Tdark)
UniProt: Q96M94 V9HWF1
Position
Xp22.11
AA seq 604 aa AA seqDB search
MAGDVEGFCSSIHDTSVSAGFRALYEEGLLLDVTLVIEDHQFQAHKALLATQSDYFRIMF
TADMRERDQDKIHLKGLTATGFSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKFC
CSFLLAKICLENCAEIMRLLDDFGVNIEGVREKLDTFLLDNFVPLMSRPDFLSYLSFEKL
MSYLDNDHLSRFPEIELYEAVQSWLRHDRRRWRHTDTIIQNIRFCLMTPTSVFEKVKTSE
FYRYSRQLRYEVDQALNYFQNVHQQPLLDMKSSRIRSAKPQTTVFRGMIGHSMVNSKILL
LKKPRVWWELEGPQVPLRPDCLAIVNNFVFLLGGEELGPDGEFHASSKVFRYDPRQNSWL
QMADMSVPRSEFAVGVIGKFIYAVAGRTRDETFYSTERYDITNDKWEFVDPYPVNKYGHE
GTVLNNKLFITGGITSSSTSKQVCVFDPSKEGTIEQRTRRTQVVTNCWENKSKMNYARCF
HKMISYNGKLYVFGGVCVILRASFESQGCPSTEVYNPETDQWTILASMPIGRSGHGVTVL
DKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVCNLHFPDYVLDEV
RRCN
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggacgtggaaggattctgttcctccatccacgacaccagtgtctctgctggg
ttcagagcactgtatgaggagggattgcttcttgatgtcactctggttattgaagatcat
cagttccaggcccataaagcactcttggccacccagagtgattacttcagaattatgttt
actgcagacatgagggaacgagatcaggacaaaattcatttaaaaggtctaacagctacc
ggtttcagccatgtcctgcaatttatgtactatggaactatagagctgagtatgaatacc
gttcatgagattcttcaggctgccatgtatgttcaacttatagaagtggtgaagttctgc
tgctcttttctcttagcgaagatctgcctagaaaattgtgcagaaattatgagactctta
gatgatttcggcgtaaacatcgagggagtcagggagaagttagacacctttctgctagac
aactttgtgccactcatgtctaggcctgactttctgtcctatctgagctttgagaagctc
atgtcttacttggataatgatcatctgagcaggttcccagagatagagctgtacgaggct
gtgcagtcttggctgcggcatgatagaagacgctggagacataccgataccatcattcag
aatatccggttttgcttgatgaccccaaccagcgtttttgagaaggttaagacatcagaa
ttttatagatactcccgacagctccgttacgaagttgaccaagcattgaattactttcag
aatgttcaccagcagcctttgttggatatgaagtcaagccgcatccgttctgcaaaaccg
caaactacagtatttcgaggaatgattggacatagcatggttaacagtaaaatacttctc
ttaaagaaaccaagagtctggtgggagctagaaggcccacaagtacctctgcgacctgac
tgccttgctatcgtcaataattttgtgttcctgttaggcggggaagagctgggcccggat
ggtgaattccatgcttcttccaaagtattcaggtatgacccgagacagaactcctggctg
cagatggcagatatgtctgtaccacgctctgaatttgctgtaggtgttattgggaagttt
atttacgccgtagcaggcagaaccagagatgagactttctattcaactgagagatatgac
atcaccaacgataaatgggaatttgtggatccttatccagttaacaaatatggacatgag
gggacagtgctcaataacaaattgtttatcaccggtggaatcacctcatcttccacctcc
aagcaagtgtgcgtgtttgaccccagcaaagaagggaccatagaacaacggaccaggaga
actcaagtggttaccaactgttgggagaataagagcaagatgaattacgcgagatgcttt
cacaagatgatttcttacaatggcaagctttatgtcttcggtggtgtctgtgtgatcttg
agggcctctttcgaatctcagggatgcccttctacagaagtatacaacccagagactgat
cagtggaccatcttggcatccatgccgattggtagaagtggccatggtgtgactgtgctg
gacaaacaaataatggttcttggaggcctttgttataatggtcattacagcgattccatc
ctcacttttgatccggatgaaaacaagtggaaggaagatgagtaccctcggatgccctgc
aagctggatggtttacaagtatgcaacctgcattttccggactatgtactggatgaggtc
aggcgttgcaactaa

DBGET integrated database retrieval system