KEGG   Homo sapiens (human): 80319Help
Entry
80319             CDS       T01001                                 

Gene name
CXXC4, IDAX
Definition
CXXC finger protein 4
Orthology
K03344  
Dvl-binding protein IDAX
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    80319 (CXXC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q22-q24
AA seq 367 aa AA seqDB search
MNTNVCVEPGPSPEAPGLPKESHLPEGALNSLVDYNSEMERYRSFATSFYKTNGGAFPQA
AKIARITTPIFPSSAAAAAAAARIGMSPWNCDNAATAAAATAMLWGSGGGGGGGGGGGGG
GGGGGGGGGGGGGGRKSSSAAASSSASSSSAILPAGGGGGGGGGGSRTSMHHRNDSQRLG
KAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIP
ALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANP
AKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSA
EAFRWFF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaatgtctgcgtggagcccgggccgagcccggaggccccgggcttgcccaag
gaaagccacttgcccgagggggctctgaacagccttgtggattacaactcggaaatggag
cgctaccgctcctttgccacctccttctacaagaccaacgggggcgccttcccacaggcg
gccaagatcgcgcgcatcaccacccccatcttccccagcagcgccgccgccgccgcggcc
gccgcgcgcatcggcatgtccccctggaactgcgacaacgcggccaccgccgccgccgcc
accgccatgctctggggcagcggcgggggcgggggcggcggcggggggggtggcggcggc
ggcggcggcggcggaggcgggggcgggggtggtgggggcggcaggaaatcctcctccgcc
gccgcctcctcctccgcctcctcctcctcggcgatcctccccgccggcggtggcggcggc
ggcggcggcggcggcagcaggaccagcatgcaccaccgaaacgactcccagaggctgggg
aaagctggctgcccgccagagccgtcgttgcaaatggcaaatactaatttcctctccacc
ttatcccctgaacactgcagacctttggcgggggaatgcatgaacaagctcaaatgcggc
gctgctgaagcagagataatgaatctccccgagcgcgtggggactttttccgctatcccg
gctttagggggcatctcattacctccaggggtcatcgtcatgacagcccttcactccccc
gcagcagcctcagcagccgtcacagacagtgcgtttcaaattgccaatctggcagactgc
ccgcagaatcattcctcctcctcctcgtcctcctcagggggagctggcggagccaaccca
gccaagaagaagaggaaaaggtgtggggtctgcgtgccctgcaagaggctcatcaactgt
ggcgtctgcagcagttgcaggaaccgcaaaacgggacaccagatctgcaaatttagaaaa
tgtgaagagctaaagaaaaaacctggcacttcactagagagaacacctgttcccagcgct
gaagcattccgatggttcttttaa

DBGET integrated database retrieval system