KEGG   Homo sapiens (human): 80329Help
Entry
80329             CDS       T01001                                 

Gene name
ULBP1, RAET1I
Definition
UL16 binding protein 1
Orthology
K07986  
UL16 binding protein
Organism
hsa  Homo sapiens (human)
Pathway
Natural killer cell mediated cytotoxicity
Class
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q25
AA seq 244 aa AA seqDB search
MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERP
FLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLT
LQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTM
FFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPKAMATTLSPWSLLIIFLCFI
LAGR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggccgccagccccgcgttccttctgtgcctcccgcttctgcacctgctgtct
ggctggtcccgggcaggatgggtcgacacacactgtctttgctatgacttcatcatcact
cctaagtccagacctgaaccacagtggtgtgaagttcaaggcctggtggatgaaaggcct
tttcttcactatgactgtgttaaccacaaggccaaagcctttgcttctctggggaagaaa
gtcaatgtcacaaaaacctgggaagaacaaactgaaacactaagagacgtggtggatttc
cttaaagggcaactgcttgacattcaagtggagaatttaatacccattgagcccctcacc
ctgcaggccaggatgtcttgtgagcatgaagcccatggacacggcagaggatcttggcag
ttcctcttcaatggacagaagttcctcctctttgactcaaacaacagaaagtggacagca
cttcatcctggagccaagaagatgacagagaagtgggagaagaacagggatgtgaccatg
ttcttccagaagatttcactgggggattgtaagatgtggcttgaagaatttttgatgtac
tgggaacaaatgctggatccaacaaaaccaccctctctggccccaggcacaacccaaccc
aaggccatggccaccaccctcagtccctggagccttctcatcatcttcctctgcttcatt
ctagctggcagatga

DBGET integrated database retrieval system