KEGG   Homo sapiens (human): 80332Help
Entry
80332             CDS       T01001                                 

Gene name
ADAM33, C20orf153, DJ964F7.1
Definition
(RefSeq) ADAM metallopeptidase domain 33
  KO
K08616  
disintegrin and metalloproteinase domain-containing protein 33 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Disease
H00079  
Asthma
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     80332 (ADAM33)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   80332 (ADAM33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20p13
AA seq 813 aa AA seqDB search
MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQPWRTVSLEEPV
SKPDMGLVALEAEGQELLLELEKNHRLLAPGYIETHYGPDGQPVVLAPNHTDHCHYQGRV
RGFPDSWVVLCTCSGMSGLITLSRNASYYLRPWPPRGSKDFSTHEIFRMEQLLTWKGTCG
HRDPGNKAGMTSLPGGPQSRGRREARRTRKYLELYIVADHTLFLTRHRNLNHTKQRLLEV
ANYVDQLLRTLDIQVALTGLEVWTERDRSRVTQDANATLWAFLQWRRGLWAQRPHDSAQL
LTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMAHEIGHSLGLSHDPDGC
CVEAAAESGGCVMAAATGHPFPRVFSACSRRQLRAFFRKGGGACLSNAPDPGLPVPPALC
GNGFVEAGEECDCGPGQECRDLCCFAHNCSLRPGAQCAHGDCCVRCLLKPAGALCRQAMG
DCDLPEFCTGTSSHCPPDVYLLDGSPCARGSGYCWDGACPTLEQQCQQLWGPGSHPAPEA
CFQVVNSAGDAHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLD
GQEVTCRGALALPSAQLDLLGLGLVEPGTQCGPRMVCQSRRCRKNAFQELQRCLTACHSH
GVCNSNHNCHCAPGWAPPFCDKPGFGGSMDSGPVQAENHDTFLLAMLLSVLLPLLPGAGL
AWCCYRLPGAHLQRCSWGCRRDPACSGPKDGPHRDHPLGGVHPMELGPTATGQPWPLDPE
NSHEPSSHPEKPLPAVSPDPQADQVQMPRSCLW
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgggctggaggccccggagagctcgggggaccccgttgctgctgctgctactactgctg
ctgctctggccagtgccaggcgccggggtgcttcaaggacatatccctgggcagccagtc
accccgcactgggtcctggatggacaaccctggcgcaccgtcagcctggaggagccggtc
tcgaagccagacatggggctggtggccctggaggctgaaggccaggagctcctgcttgag
ctggagaagaaccacaggctgctggccccaggatacatagaaacccactacggcccagat
gggcagccagtggtgctggcccccaaccacacggatcattgccactaccaagggcgagta
aggggcttccccgactcctgggtagtcctctgcacctgctctgggatgagtggcctgatc
accctcagcaggaatgccagctattatctgcgtccctggccaccccggggctccaaggac
ttctcaacccacgagatctttcggatggagcagctgctcacctggaaaggaacctgtggc
cacagggatcctgggaacaaagcgggcatgaccagccttcctggtggtccccagagcagg
ggcaggcgagaagcgcgcaggacccggaagtacctggaactgtacattgtggcagaccac
accctgttcttgactcggcaccgaaacttgaaccacaccaaacagcgtctcctggaagtc
gccaactacgtggaccagcttctcaggactctggacattcaggtggcgctgaccggcctg
gaggtgtggaccgagcgggaccgcagccgcgtcacgcaggacgccaacgccacgctctgg
gccttcctgcagtggcgccgggggctgtgggcgcagcggccccacgactccgcgcagctg
ctcacgggccgcgccttccagggcgccacagtgggcctggcgcccgtcgagggcatgtgc
cgcgccgagagctcgggaggcgtgagcacggaccactcggagctccccatcggcgccgca
gccaccatggcccatgagatcggccacagcctcggcctcagccacgaccccgacggctgc
tgcgtggaggctgcggccgagtccggaggctgcgtcatggctgcggccaccgggcacccg
tttccgcgcgtgttcagcgcctgcagccgccgccagctgcgcgccttcttccgcaagggg
ggcggcgcttgcctctccaatgccccggaccccggactcccggtgccgccggcgctctgc
gggaacggcttcgtggaagcgggcgaggagtgtgactgcggccctggccaggagtgccgc
gacctctgctgctttgctcacaactgctcgctgcgcccgggggcccagtgcgcccacggg
gactgctgcgtgcgctgcctgctgaagccggctggagcgctgtgccgccaggccatgggt
gactgtgacctccctgagttttgcacgggcacctcctcccactgtcccccagacgtttac
ctactggacggctcaccctgtgccaggggcagtggctactgctgggatggcgcatgtccc
acgctggagcagcagtgccagcagctctgggggcctggctcccacccagctcccgaggcc
tgtttccaggtggtgaactctgcgggagatgctcatggaaactgcggccaggacagcgag
ggccacttcctgccctgtgcagggagggatgccctgtgtgggaagctgcagtgccagggt
ggaaagcccagcctgctcgcaccgcacatggtgccagtggactctaccgttcacctagat
ggccaggaagtgacttgtcggggagccttggcactccccagtgcccagctggacctgctt
ggcctgggcctggtagagccaggcacccagtgtggacctagaatggtgtgccagagcagg
cgctgcaggaagaatgccttccaggagcttcagcgctgcctgactgcctgccacagccac
ggggtttgcaatagcaaccataactgccactgtgctccaggctgggctccacccttctgt
gacaagccaggctttggtggcagcatggacagtggccctgtgcaggctgaaaaccatgac
accttcctgctggccatgctcctcagcgtcctgctgcctctgctcccaggggccggcctg
gcctggtgttgctaccgactcccaggagcccatctgcagcgatgcagctggggctgcaga
agggaccctgcgtgcagtggccccaaagatggcccacacagggaccaccccctgggcggc
gttcaccccatggagttgggccccacagccactggacagccctggcccctggaccctgag
aactctcatgagcccagcagccaccctgagaagcctctgccagcagtctcgcctgacccc
caagcagatcaagtccagatgccaagatcctgcctctggtga

DBGET integrated database retrieval system