KEGG   Homo sapiens (human): 80333Help
Entry
80333             CDS       T01001                                 

Gene name
KCNIP4, CALP, KCHIP4
Definition
(RefSeq) potassium voltage-gated channel interacting protein 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_9 EF-hand_4 DUF5314
Motif
Other DBs
NCBI-GeneID: 80333
NCBI-ProteinID: NP_079497
OMIM: 608182
HGNC: 30083
Ensembl: ENSG00000185774
Vega: OTTHUMG00000128557
Pharos: Q6PIL6(Tbio)
UniProt: Q6PIL6
Position
4p15.31-p15.2
AA seq 250 aa AA seqDB search
MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDE
LEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGD
STTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEE
MLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIM
RSMQLFENVI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgaggagggtggaaagcatttcggctcagctggaggaggccagctctacaggc
ggtttcctgtacgctcagaacagcaccaagcgcagcattaaagagcggctcatgaagctc
ttgccctgctcagctgccaaaacgtcgtctcctgctattcaaaacagcgtggaagatgaa
ctggagatggccaccgtcaggcatcggcctgaagcccttgagcttctggaagcccagagc
aaatttaccaagaaagagcttcagatcctttacagaggatttaagaatgaatgccccagt
ggtgttgttaatgaagaaaccttcaaagagatttactcgcagttctttccacagggagac
tctacaacatatgcacattttctgttcaatgcatttgatacagaccacaatggagctgtg
agtttcgaggatttcatcaaaggtctttccattttgctccgggggacagtacaagaaaaa
ctcaattgggcatttaatctgtatgacataaataaagatggctacatcactaaagaggaa
atgcttgatataatgaaagcaatatacgatatgatgggtaaatgtacatatcctgtcctc
aaagaagatgctcccagacaacacgttgaaacattttttcagaaaatggacaaaaataaa
gatggggttgttaccatagatgagttcattgaaagctgccaaaaagatgaaaacataatg
cgctccatgcagctctttgaaaatgtgatttaa

DBGET integrated database retrieval system