KEGG   Homo sapiens (human): 80333Help
Entry
80333             CDS       T01001                                 

Gene name
KCNIP4, CALP, KCHIP4
Definition
(RefSeq) potassium voltage-gated channel interacting protein 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p15.32
AA seq 250 aa AA seqDB search
MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDE
LEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGD
STTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEE
MLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIM
RSMQLFENVI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgaggagggtggaaagcatttcggctcagctggaggaggccagctctacaggc
ggtttcctgtacgctcagaacagcaccaagcgcagcattaaagagcggctcatgaagctc
ttgccctgctcagctgccaaaacgtcgtctcctgctattcaaaacagcgtggaagatgaa
ctggagatggccaccgtcaggcatcggcctgaagcccttgagcttctggaagcccagagc
aaatttaccaagaaagagcttcagatcctttacagaggatttaagaatgaatgccccagt
ggtgttgttaatgaagaaaccttcaaagagatttactcgcagttctttccacagggagac
tctacaacatatgcacattttctgttcaatgcatttgatacagaccacaatggagctgtg
agtttcgaggatttcatcaaaggtctttccattttgctccgggggacagtacaagaaaaa
ctcaattgggcatttaatctgtatgacataaataaagatggctacatcactaaagaggaa
atgcttgatataatgaaagcaatatacgatatgatgggtaaatgtacatatcctgtcctc
aaagaagatgctcccagacaacacgttgaaacattttttcagaaaatggacaaaaataaa
gatggggttgttaccatagatgagttcattgaaagctgccaaaaagatgaaaacataatg
cgctccatgcagctctttgaaaatgtgatttaa

DBGET integrated database retrieval system