KEGG   Homo sapiens (human): 80339Help
Entry
80339             CDS       T01001                                 

Gene name
PNPLA3, ADPN, C22orf20, iPLA(2)epsilon
Definition
(RefSeq) patatin like phospholipase domain containing 3
  KO
K13534  
patatin-like phospholipase domain-containing protein 3 [EC:3.1.1.3 2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Disease
H01333  
Nonalcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    80339 (PNPLA3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     80339 (PNPLA3)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     80339 (PNPLA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NST1(Tbio)
UniProt: 
Position
22q13.31
AA seq 481 aa AA seqDB search
MYDAERGWSLSFAGCGFLGFYHVGATRCLSEHAPHLLRDARMLFGASAGALHCVGVLSGI
PLEQTLQVLSDLVRKARSRNIGIFHPSFNLSKFLRQGLCKCLPANVHQLISGKIGISLTR
VSDGENVLVSDFRSKDEVVDALVCSCFIPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKT
TITVSPFYGEYDICPKVKSTNFLHVDITKLSLRLCTGNLYLLSRAFVPPDLKVLGEICLR
GYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDE
LLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRIMSYVMLPCTL
PVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCT
PEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacgcagagcgcggctggagcttgtccttcgcgggctgcggcttcctgggcttc
taccacgtcggggcgacccgctgcctgagcgagcacgccccgcacctcctccgcgacgcg
cgcatgttgttcggcgcttcggccggggcgttgcactgcgtcggcgtcctctccggtatc
ccgctggagcagactctgcaggtcctctcagatcttgtgcggaaggccaggagtcggaac
attggcatcttccatccatccttcaacttaagcaagttcctccgacagggtctctgcaaa
tgcctcccggccaatgtccaccagctcatctccggcaaaataggcatctctcttaccaga
gtgtctgatggggaaaacgttctggtgtctgactttcggtccaaagacgaagtcgtggat
gccttggtatgttcctgcttcatccccttctacagtggccttatccctccttccttcaga
ggcgtgcgatatgtggatggaggagtgagtgacaacgtacccttcattgatgccaaaaca
accatcaccgtgtcccccttctatggggagtacgacatctgccctaaagtcaagtccacg
aactttcttcatgtggacatcaccaagctcagtctacgcctctgcacagggaacctctac
cttctctcgagagcttttgtccccccggatctcaaggtgctgggagagatatgccttcga
ggatatttggatgcattcaggttcttggaagagaagggcatctgcaacaggccccagcca
ggcctgaagtcatcctcagaagggatggatcctgaggtcgccatgcccagctgggcaaac
atgagtctggattcttccccggagtcggctgccttggctgtgaggctggagggagatgag
ctgctagaccacctgcgtctcagcatcctgccctgggatgagagcatcctggacaccctc
tcgcccaggctcgctacagcactgagtgaagaaatgaaagacaaaggtggatacatgagc
aagatttgcaacttgctacccattaggataatgtcttatgtaatgctgccctgtaccctg
cctgtggaatctgccattgcgattgtccagagactggtgacatggcttccagatatgccc
gacgatgtcctgtggttgcagtgggtgacctcacaggtgttcactcgagtgctgatgtgt
ctgctccccgcctccaggtcccaaatgccagtgagcagccaacaggcctccccatgcaca
cctgagcaggactggccctgctggactccctgctcccccaagggctgtccagcagagacc
aaagcagaggccaccccgcggtccatcctcaggtccagcctgaacttcttcttgggcaat
aaagtacctgctggtgctgaggggctctccacctttcccagtttttcactagagaagagt
ctgtga

DBGET integrated database retrieval system