KEGG   Homo sapiens (human): 80381Help
Entry
80381             CDS       T01001                                 

Gene name
CD276, 4Ig-B7-H3, B7-H3, B7H3, B7RP-2
Definition
(RefSeq) CD276 molecule
  KO
K06746  
immune costimulatory protein B7-H3
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    80381 (CD276)
Cellular antigens [BR:hsa04090]
 Proteins
  80381 (CD276)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q5ZPR3(Tbio)
UniProt: 
Position
15q24.1
AA seq 534 aa AA seqDB search
MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSL
AQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSF
TCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQD
GQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQ
RSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEG
RDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPY
SKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLF
DVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIAL
LVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtcggcggggcagccctggcatgggtgtgcatgtgggtgcagccctgggagca
ctgtggttctgcctcacaggagccctggaggtccaggtccctgaagacccagtggtggca
ctggtgggcaccgatgccaccctgtgctgctccttctcccctgagcctggcttcagcctg
gcacagctcaacctcatctggcagctgacagataccaaacagctggtgcacagctttgct
gagggccaggaccagggcagcgcctatgccaaccgcacggccctcttcccggacctgctg
gcacagggcaacgcatccctgaggctgcagcgcgtgcgtgtggcggacgagggcagcttc
acctgcttcgtgagcatccgggatttcggcagcgctgccgtcagcctgcaggtggccgct
ccctactcgaagcccagcatgaccctggagcccaacaaggacctgcggccaggggacacg
gtgaccatcacgtgctccagctaccagggctaccctgaggctgaggtgttctggcaggat
gggcagggtgtgcccctgactggcaacgtgaccacgtcgcagatggccaacgagcagggc
ttgtttgatgtgcacagcatcctgcgggtggtgctgggtgcaaatggcacctacagctgc
ctggtgcgcaaccccgtgctgcagcaggatgcgcacagctctgtcaccatcacaccccag
agaagccccacaggagccgtggaggtccaggtccctgaggacccggtggtggccctagtg
ggcaccgatgccaccctgcgctgctccttctcccccgagcctggcttcagcctggcacag
ctcaacctcatctggcagctgacagacaccaaacagctggtgcacagtttcaccgaaggc
cgggaccagggcagcgcctatgccaaccgcacggccctcttcccggacctgctggcacaa
ggcaatgcatccctgaggctgcagcgcgtgcgtgtggcggacgagggcagcttcacctgc
ttcgtgagcatccgggatttcggcagcgctgccgtcagcctgcaggtggccgctccctac
tcgaagcccagcatgaccctggagcccaacaaggacctgcggccaggggacacggtgacc
atcacgtgctccagctaccggggctaccctgaggctgaggtgttctggcaggatgggcag
ggtgtgcccctgactggcaacgtgaccacgtcgcagatggccaacgagcagggcttgttt
gatgtgcacagcgtcctgcgggtggtgctgggtgcgaatggcacctacagctgcctggtg
cgcaaccccgtgctgcagcaggatgcgcacggctctgtcaccatcacagggcagcctatg
acattccccccagaggccctgtgggtgaccgtggggctgtctgtctgtctcattgcactg
ctggtggccctggctttcgtgtgctggagaaagatcaaacagagctgtgaggaggagaat
gcaggagctgaggaccaggatggggagggagaaggctccaagacagccctgcagcctctg
aaacactctgacagcaaagaagatgatggacaagaaatagcctga

DBGET integrated database retrieval system