KEGG   Homo sapiens (human): 8048Help
Entry
8048              CDS       T01001                                 

Gene name
CSRP3, CLP, CMD1M, CMH12, CRP3, LMO4, MLP
Definition
cysteine and glycine-rich protein 3 (cardiac LIM protein)
Orthology
K09377  
cysteine and glycine-rich protein
Organism
hsa  Homo sapiens (human)
Disease
H00292  
Hypertrophic cardiomyopathy (HCM)
H00294  
Dilated cardiomyopathy (DCM)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.1
AA seq 194 aa AA seqDB search
MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKV
CYGRRYGPKGIGYGQGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKC
PRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTG
IGFGGLTQQVEKKE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgccaaactggggcggaggcgcaaaatgtggagcctgtgaaaagaccgtctaccatgca
gaagaaatccagtgcaatggaaggagtttccacaagacgtgtttccactgcatggcctgc
aggaaggctcttgacagcacgacagtcgcggctcatgagtcggagatctactgcaaggtg
tgctatgggcgcagatatggccccaaagggatcgggtatggacaaggcgctggctgtctc
agcacagacacgggcgagcatctcggcctgcagttccaacagtccccaaagccggcacgc
tcagttaccaccagcaacccttccaaattcactgcgaagtttggagagtccgagaagtgc
cctcgatgtggcaagtcagtctatgctgctgagaaggttatgggaggtggcaagccttgg
cacaagacctgtttccgctgtgccatctgtgggaagagtctggagtccacaaatgtcact
gacaaagatggggaactttattgcaaagtttgctatgccaaaaattttggccccacgggt
attgggtttggaggccttacacaacaagtggaaaagaaagaatga

DBGET integrated database retrieval system