KEGG   Homo sapiens (human): 80704Help
Entry
80704             CDS       T01001                                 

Gene name
SLC19A3, BBGD, THMD2, THTR2
Definition
solute carrier family 19 (thiamine transporter), member 3
Orthology
K14610  
solute carrier family 19 (thiamine transporter), member 2/3
Organism
hsa  Homo sapiens (human)
Pathway
Vitamin digestion and absorption
Disease
H01231  
Biotin-responsive basal ganglia disease (BBGD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    80704 (SLC19A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37
AA seq 496 aa AA seqDB search
MDCYRTSLSSSWIYPTVILCLFGFFSMMRPSEPFLIPYLSGPDKNLTSAEITNEIFPVWT
YSYLVLLLPVFVLTDYVRYKPVIILQGISFIITWLLLLFGQGVKTMQVVEFFYGMVTAAE
VAYYAYIYSVVSPEHYQRVSGYCRSVTLAAYTAGSVLAQLLVSLANMSYFYLNVISLASV
SVAFLFSLFLPMPKKSMFFHAKPSREIKKSSSVNPVLEETHEGEAPGCEEQKPTSEILST
SGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKRLFYWSLWWAFATAGFNQVLNYVQ
ILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGYVKVNWDLLGELALVVFSVVNAGSL
FLMHYTANIWACYAGYLIFKSSYMLLITIAVFQIAVNLNVERYALVFGINTFIALVIQTI
MTVIVVDQRGLNLPVSIQFLVYGSYFAVIAGIFLMRSMYITYSTKSQKDVQSPAPSENPD
VSHPEEESNIIMSTKL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggattgttacagaacttcactaagcagttcctggatttaccccactgtgatcctctgc
ttatttggttttttctccatgatgagaccctcagaaccattccttatcccatatttatct
ggaccagataaaaacctgaccagtgcagagataacaaatgagatcttccccgtttggaca
tactcctacctggtgctgctgctgcctgtgtttgtcctcaccgattatgtccgctacaag
ccagtcatcatcttgcaaggtatcagtttcatcattacctggctgctgctgttgtttggc
caaggagtgaagaccatgcaggttgtagagttcttctatgggatggtcaccgccgccgag
gtggcctactacgcctacatatacagcgtggtcagccccgagcactaccagagagtgagc
ggctactgcaggagcgtcacgctggccgcctacacagcagggtcggtgctggctcaactc
ttggtatccctggcgaacatgtcgtacttttacctcaacgtcatatccttggcctctgtc
tccgtggctttccttttctcacttttcctaccaatgcccaagaaaagcatgttttttcat
gcaaaacccagcagagaaataaagaagtcatcaagcgtgaatccagtattagaggaaact
cacgaaggtgaagcaccaggctgtgaagagcagaaacccacatcagaaatactcagcact
tcagggaagctgaataagggccagctgaacagcctgaaaccaagcaatgtgactgtggac
gtttttgtgcagtggttccaagatttgaaggagtgctactcctcaaaacgtcttttctac
tggtctctatggtgggctttcgccacagcaggttttaaccaggttttgaactatgttcaa
atcctgtgggattacaaggcgccatcccaagattcttccatctataatggggccgtagaa
gctattgcaacctttggaggggctgtggctgcctttgcagtgggttatgtgaaagtcaac
tgggaccttctgggagagctggctctggtggtcttctcagttgtcaatgccggttcttta
tttctcatgcattacacagccaatatctgggcgtgctatgctggctatttgatattcaag
tccagctatatgcttcttataaccatagcagtatttcagattgcagttaatctgaatgtg
gaacgctatgccttggtatttggaatcaacacctttattgccttggtgattcagaccatc
atgactgtgattgtagtagatcagagagggctcaacttgccagtcagcattcagttttta
gtttatgggagctattttgcagtaattgctggaattttcctaatgagaagcatgtatatt
acctactcaaccaaatcccagaaggatgtacagagccctgctccaagtgagaatccagat
gtgtctcacccagaggaagagagtaatatcatcatgtcaacaaaactctaa

DBGET integrated database retrieval system