KEGG   Homo sapiens (human): 8074Help
Entry
8074              CDS       T01001                                 

Gene name
FGF23, ADHR, FGFN, HPDR2, HYPF, PHPTC
Definition
fibroblast growth factor 23
Orthology
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Melanoma
Disease
H00214  
Hypophosphatemic rickets
H01193  
Familial tumoral calcinosis (FTC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    8074 (FGF23)
   04015 Rap1 signaling pathway
    8074 (FGF23)
   04010 MAPK signaling pathway
    8074 (FGF23)
   04151 PI3K-Akt signaling pathway
    8074 (FGF23)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    8074 (FGF23)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8074 (FGF23)
   05205 Proteoglycans in cancer
    8074 (FGF23)
   05218 Melanoma
    8074 (FGF23)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  8074 (FGF23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13.3
AA seq 251 aa AA seqDB search
MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTL
ENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRS
AEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTG
PEGCRPFAKFI
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgttgggggcccgcctcaggctctgggtctgtgccttgtgcagcgtctgcagcatgagc
gtcctcagagcctatcccaatgcctccccactgctcggctccagctggggtggcctgatc
cacctgtacacagccacagccaggaacagctaccacctgcagatccacaagaatggccat
gtggatggcgcaccccatcagaccatctacagtgccctgatgatcagatcagaggatgct
ggctttgtggtgattacaggtgtgatgagcagaagatacctctgcatggatttcagaggc
aacatttttggatcacactatttcgacccggagaactgcaggttccaacaccagacgctg
gaaaacgggtacgacgtctaccactctcctcagtatcacttcctggtcagtctgggccgg
gcgaagagagccttcctgccaggcatgaacccacccccgtactcccagttcctgtcccgg
aggaacgagatccccctaattcacttcaacacccccataccacggcggcacacccggagc
gccgaggacgactcggagcgggaccccctgaacgtgctgaagccccgggcccggatgacc
ccggccccggcctcctgttcacaggagctcccgagcgccgaggacaacagcccgatggcc
agtgacccattaggggtggtcaggggcggtcgagtgaacacgcacgctgggggaacgggc
ccggaaggctgccgccccttcgccaagttcatctag

DBGET integrated database retrieval system