KEGG   Homo sapiens (human): 80759Help
Entry
80759             CDS       T01001                                 

Gene name
KHDC1, C6orf147, C6orf148, Em:AC019205.8, NDG1, bA257K9.4
Definition
(RefSeq) KH homology domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q13
AA seq 237 aa AA seqDB search
MLSAFQRLFRVLFVIETVSEYGVLIFIYGWPFLQTLAMLLIGTVSFHLWIRRNRERNSRS
GKTRCRSKRSEQSMDMGTSALSKKPWWTLPQNFHAPMVFHMEEDQEELIFGHGDTYLRCI
EVHSHTLIQLESWFTATGQTRVTVVGPHRARQWLLHMFCCVGSQDSYHHARGLEMLERVR
SQPLTNDDLVTSISVPPYTGDLSLAPRISGTVCLSVPQPSPYQVIGCSGFHLSSLYP
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcggccttccagaggctgttccgagtcttatttgtgattgaaacagtctcagaa
tacggagtcctgatcttcatttatggatggccctttctccagacccttgcgatgctcctg
atcgggacagtgtctttccacctttggatccgcagaaatcgagagagaaactcaaggagc
ggaaagactagatgccgatccaaaaggtcggagcagagcatggacatgggaacgagtgct
ctcagcaagaagccgtggtggaccctgcctcaaaactttcatgcaccaatggtgtttcac
atggaagaggaccaggaggagctcatcttcgggcatggtgacacataccttcgctgcatt
gaggtgcacagccacacccttattcagctggagagttggttcacagctacaggccagact
cgtgtgactgtagtcggaccacacagggcaaggcagtggctgctgcacatgttttgttgt
gtggggagccaggactcctatcatcatgctcgaggcctggagatgctggaacgtgtccga
agccagcctctgaccaacgatgacctggtcacctccattagtgtgccaccatacactgga
gacctgtctttggctcccaggataagtggaaccgtgtgtcttagcgttcctcagccttcc
ccttaccaagtgattggttgttcgggtttccatttgagttcactgtatccgtaa

DBGET integrated database retrieval system