KEGG   Homo sapiens (human): 8078Help
Entry
8078              CDS       T01001                                 

Gene name
USP5, ISOT
Definition
ubiquitin specific peptidase 5 (isopeptidase T) (EC:3.4.19.12)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13
AA seq 858 aa AA seqDB search
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVER
HFNKTGQRVYLHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDV
KIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
FSLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRET
GYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDM
NQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEK
IFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKAL
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT
QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKMALPELVRAQVPFSSCLEAYGAPE
QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS
QLRGTGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPTSPMLDESVI
IQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSTSAAA
DPPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSA
ADSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCAS
EKPPKDLGYIYFYQRVAS
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgagtgaggaggcgctgctgtcagtattaccgacgatccgggtccctaag
gctggagaccgggtccacaaagacgagtgcgccttctccttcgacacgccggagtctgag
gggggcctctacatctgtatgaacacgtttctgggctttgggaaacagtatgtggagaga
catttcaataagaccggccagcgagtctacttgcacctccggcggacccggcgcccgaaa
gaggaggaccctgctacaggcactggagacccaccccggaagaagcccacgcggctggct
attggtgttgaaggcggatttgaccttagcgaggagaagtttgaattagacgaggatgtg
aagattgtcattttgccagattacctggagattgcccgggatggactggggggactgcct
gacattgtcagagatcgggtgaccagtgcagtggaggccctactgtcggccgactcagcc
tcccgcaagcaggaggtgcaggcatgggatggggaagtacggcaggtgtctaagcatgcc
ttcagcctcaagcagttggacaaccctgctcgaatccctccctgtggctggaagtgctcc
aagtgtgacatgagagagaacctgtggctcaacctgactgatggctccatcctctgtggg
cgacgctacttcgatggcagtgggggcaacaaccacgctgtggagcactaccgagagaca
ggctacccgttagctgtcaagctgggcaccatcacccctgatggagctgacgtgtactca
tatgatgaggatgacatggtcctggaccccagcctggctgagcacctgtcccacttcggc
atcgacatgctgaagatgcagaagacagacaagacgatgactgagttggagatagacatg
aaccagcggattggtgaatgggagctgatccaggagtcaggtgtgccactcaagcccctg
tttgggcctggctacacaggcatccggaacctgggtaacagctgctacctcaactctgtg
gtccaggtgctcttcagcatccctgacttccagaggaagtatgtggataagctggagaag
atcttccagaatgccccgacggaccctacccaggatttcagcacccaggtggccaagctg
ggccatggccttctctccggggagtattccaagccagtaccggagtcgggcgatggggag
cgggtgccagaacagaaggaagttcaagatggcattgcccctcggatgttcaaggccctc
atcggcaagggccaccctgaattctccaccaaccggcagcaggatgcccaggagttcttc
cttcaccttatcaacatggtggagaggaattgccggagctctgaaaatcctaatgaagtg
ttccgcttcttggtggaggaaaagatcaagtgcctggccacagagaaggtgaagtacacc
cagcgagttgactacatcatgcagctgcctgtgcccatggatgcagcccttaacaaagag
gagcttctggagtacgaggagaagaagcggcaagccgaagaggagaagatggcactgcca
gaactggttcgggcccaggtgcccttcagctcttgcctggaggcctacggggcccctgag
caggtcgatgacttctggagcacggccctgcaggccaagtcagtagctgtcaagaccaca
cgatttgcctcattccctgactacctggtcatccagatcaagaagttcaccttcggctta
gactgggtgcccaagaaactggatgtgtccatcgagatgccagaggagctcgacatctcc
cagttgaggggcacagggctgcagcccggagaggaggagctgccagacattgccccaccc
ctggtcactccggatgagcccaaaggtagccttggtttctatggcaacgaagacgaagac
tccttctgctcccctcacttctcctctccgacatcgcccatgctggatgaatcagtcatc
atccagctggtggagatgggattccctatggacgcctgccgcaaagctgtctactacacg
ggcaacagcggggctgaggccgccatgaactgggtcatgtcacacatggatgatccagat
tttgcaaaccccctcatcctgcctggctctagtgggccgggctccacaagcgcagcagcc
gacccccctcctgaggactgtgtgaccaccattgtctccatgggcttctcccgggaccag
gccttgaaagcgctgcgggccacgaacaatagtttagaacgggctgtggactggatcttc
agtcacattgacgacctggatgctgaagctgccatggacatctcagagggccgctcagct
gccgactccatctctgagtctgtgccagtgggacctaaagtccgggatggtcctggaaag
tatcagctctttgccttcattagtcacatgggcacctctaccatgtgtggtcactacgtc
tgccacatcaagaaagaaggcagatgggtgatctacaatgaccagaaagtgtgtgcctcc
gagaagccgcccaaggacctgggctacatctacttctaccagagagtggccagctaa

DBGET integrated database retrieval system