KEGG   Homo sapiens (human): 80817Help
Entry
80817             CDS       T01001                                 

Gene name
CEP44, KIAA1712, PS1TP3
Definition
(RefSeq) centrosomal protein 44
  KO
K16761  
centrosomal protein CEP44
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    80817 (CEP44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q34
AA seq 390 aa AA seqDB search
MATGDLKRSLRNLEQVLRLLNYPEEVDCVGLIKGDPAASLPIISYSFTSYSPYVTELIME
SNVELIAKNDLRFIDAVYKLLRDQFNYKPILTKKQFIQCGFAEWKIQIVCDILNCVMKKH
KELSSLQKIPSQQRKKISSGKSEPPLGNEKISAEAVGVDISGRFMTSGKKKAVVIRHLYN
EDNVDISEDTLSPITDVNEAVDVSDLNATEIKMPEVKVPEIKAEQQDVNVNPEITALQTM
LAECQENLKKLTSIEKRLDCLEQKMKGKVMVDENTWTNLLSRVTLLETEMLLSKKNDEFI
EFNEVSEDYASCSDMDLLNPHRKSEVERPASIPLSSGYSTASSDSTPRASTVNYCGLNEI
SEETTIQKMERMKKMFEETAELLKCPNHYL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaggtgacttaaaaagaagcttacggaacctagaacaggtgctccgcttgcta
aattatcctgaagaggtggactgtgtaggtttgataaagggagacccagcagcatctttg
cccatcatcagctattcttttacctcatactcaccttatgtaacagaacttataatggaa
tccaatgtagagctcatagcaaaaaatgacttgcgctttatagatgctgtctataagctt
cttcgtgatcaatttaattataaaccaattttgacaaaaaagcagtttatccaatgtggg
tttgcagaatggaaaatccaaattgtttgtgatattttgaattgtgtgatgaaaaagcac
aaggaattaagcagtcttcagaagattccatcacaacaaagaaagaaaatcagttctggt
aagtcagaacctcctttgggcaatgagaaaatatctgcagaggctgttggcgttgatatc
agtggcaggtttatgacctcaggaaagaagaaagctgtggtgattcgtcacttgtataat
gaagataatgttgacatttctgaggatacattaagtccaataacagatgttaatgaagca
gttgatgtgtctgacttaaatgctactgaaataaagatgcctgaagtaaaggttcctgaa
atcaaggctgagcaacaggatgtaaatgttaatcctgagattactgcactacaaactatg
cttgctgaatgccaagaaaatcttaagaaactgacttcgatagagaaaaggttagactgt
ttggaacaaaaaatgaaaggaaaagtgatggtagatgaaaacacctggactaatcttctt
agtcgtgtcactcttcttgaaacagaaatgcttttgtctaaaaagaatgatgaatttata
gagtttaatgaagttagtgaagactacgcttcttgtagtgacatggaccttctgaatcct
cacagaaaaagcgaagtagagaggccagcaagtattcctctgtcctctggctatagtaca
gcatcatcagattcaactcccagagcctctactgttaattactgtggtttgaatgagatt
tcagaggaaacaacaatccagaaaatggaaaggatgaaaaaaatgtttgaagaaactgca
gagttactgaaatgtccaaatcactacttgtag

DBGET integrated database retrieval system