KEGG   Homo sapiens (human): 80829Help
Entry
80829             CDS       T01001                                 

Gene name
ZFP91, DMS-8, DSM-8, PZF, ZFP-91, ZNF757
Definition
ZFP91 zinc finger protein
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q12
AA seq 569 aa AA seqDB search
MPGETEEPRPPEQQDQEGGEAAKAAPEEPQQRPPEAVAAAPAGTTSSRVLRGGRDRGRAA
AAAAAAAVSRRRKAEYPRRRRSSPSARPPDVPGQQPQAAKSPSPVQGKKSPRLLCIEKVT
TDKDPKEEKEEEDDSALPQEVSIAASRPSRGWRSSRTSVSRHRDTENTRSSRSKTGSLQL
ICKSEPNTDQLDYDVGEEHQSPGGISEEEEEEEEEMLISEEEIPFKDDPRDETYKPHLER
ETPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEENEIREDEEPPRKRGRRRKDDKSPRLPK
RRKKPPIQYVRCEMEGCGTVLAHPRYLQHHIKYQHLLKKKYVCPHPSCGRLFRLQKQLLR
HAKHHTDQRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKK
HDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEVLIAEALAANAGALITSTDILGTNPE
SLTQPSDGQGLPLLPEPLGNSTSGECLLLEAEGMSKSYCSGTERVSLMADGKIFVGSGSS
GGTEGLVMNSDILGATTEVLIEDSDSAGP
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgccgggggagacggaagagccgagacccccggagcagcaggaccaggaagggggagag
gcggccaaggcggctccggaggagccccaacaacggccccctgaggcggtcgcggcggcg
cctgcagggaccactagcagccgcgtgctgaggggaggtcgggaccgaggccgggccgct
gcggccgccgccgccgcagctgtgtcccgccggaggaaggccgagtatccccgccggcgg
aggagcagccccagcgccaggcctcccgacgtccccgggcagcagccccaggccgcgaag
tccccgtctccagttcagggcaagaagagtccgcgactcctatgcatagaaaaagtaaca
actgataaagatcccaaggaagaaaaagaggaagaagacgattctgccctccctcaggaa
gtttccattgctgcatctagacctagccggggctggcgtagtagtaggacatctgtttct
cgccatcgtgatacagagaacacccgaagctctcggtccaagaccggttcattgcagctc
atttgcaagtcagaaccaaatacagaccaacttgattatgatgttggagaagagcatcag
tctccaggtggcattagtgaagaggaagaggaggaggaagaagagatgttaatcagtgaa
gaggagataccattcaaagatgatccaagagatgagacctacaaaccccacttagaaagg
gaaaccccaaagccacggagaaaatcagggaaggtaaaagaagagaaggagaagaaggaa
attaaagtggaagtagaggtggaggtgaaagaagaggagaatgaaattagagaggatgag
gaacctccaaggaagagaggaagaagacgaaaagatgacaaaagtccacgtttacccaaa
aggagaaaaaagcctccaatccagtatgtccgttgtgagatggaaggatgtggaactgtc
cttgcccatcctcgctatttgcagcaccacattaaataccagcatttgctgaagaagaaa
tatgtatgtccccatccctcctgtggacgactcttcaggcttcagaagcaacttctgcga
catgccaaacatcatacagatcaaagggattatatctgtgaatattgtgctcgggccttc
aagagttcccacaatctggcagtgcaccggatgattcacactggcgagaagccattacaa
tgtgagatctgtggatttacttgtcgacaaaaggcatctcttaattggcacatgaagaaa
catgatgcagactccttctaccagttttcttgcaatatctgtggcaaaaaatttgagaag
aaggacagcgtagtggcacacaaggcaaaaagccaccctgaggtgctgattgcagaagct
ctggctgccaatgcaggcgccctcatcaccagcacagatatcttgggcactaacccagag
tccctgacgcagccttcagatggtcagggtcttcctcttcttcctgagcccttgggaaac
tcaacctctggagagtgcctactgttagaagctgaagggatgtcaaagtcatactgcagt
gggacggaacgggtgagcctgatggctgatgggaagatctttgtgggaagcggcagcagt
ggaggcactgaagggctggttatgaactcagatatactcggtgctaccacagaggttctg
attgaagattcagactctgccggaccttag

DBGET integrated database retrieval system