KEGG   Homo sapiens (human): 80834Help
Entry
80834             CDS       T01001                                 

Gene name
TAS1R2, GPR71, T1R2, TR2
Definition
taste receptor, type 1, member 2
Orthology
K04625  
taste receptor type 1 member 2
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Carbohydrate digestion and absorption
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    80834 (TAS1R2)
  Sensory system
   04742 Taste transduction
    80834 (TAS1R2)
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Chemoreception
   Taste type 1
    80834 (TAS1R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.13
AA seq 839 aa AA seqDB search
MGPRAKTISSLFFLLWVLAEPAENSDFYLPGDYLLGGLFSLHANMKGIVHLNFLQVPMCK
EYEVKVIGYNLMQAMRFAVEEINNDSSLLPGVLLGYEIVDVCYISNNVQPVLYFLAHEDN
LLPIQEDYSNYISRVVAVIGPDNSESVMTVANFLSLFLLPQITYSAISDELRDKVRFPAL
LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL
PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVWIA
SESWAIDPVLHNLTELRHLGTFLGITIQSVPIPGFSEFREWGPQAGPPPLSRTSQSYTCN
QECDNCLNATLSFNTILRLSGERVVYSVYSAVYAVAHALHSLLGCDKSTCTKRVVYPWQL
LEEIWKVNFTLLDHQIFFDPQGDVALHLEIVQWQWDRSQNPFQSVASYYPLQRQLKNIQD
ISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPN
NEWSYQSETSCFKRQLVFLEWHEAPTIAVALLAALGFLSTLAILVIFWRHFQTPIVRSAG
GPMCFLMLTLLLVAYMVVPVYVGPPKVSTCLCRQALFPLCFTICISCIAVRSFQIVCAFK
MASRFPRAYSYWVRYQGPYVSMAFITVLKMVIVVIGMLATGLSPTTRTDPDDPKITIVSC
NPNYRNSLLFNTSLDLLLSVVGFSFAYMGKELPTNYNEAKFITLSMTFYFTSSVSLCTFM
SAYSGVLVTIVDLLVTVLNLLAISLGYFGPKCYMILFYPERNTPAYFNSMIQGYTMRRD
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggggcccagggcaaagaccatctcctccctgttcttcctcctatgggtcctggctgag
ccggctgagaactcggacttctacctgcctggggattacctcctgggtggcctcttctcc
ctccatgccaacatgaagggcattgttcaccttaacttcctgcaggtgcccatgtgcaag
gagtatgaagtgaaggtgataggctacaacctcatgcaggccatgcgctttgcggtggag
gagatcaacaatgacagcagcctgctgcctggtgtgctgctgggctatgagatcgtggat
gtgtgctacatctccaacaatgtccagccggtgctctacttcctggcacacgaggacaac
ctccttcccatccaagaggactacagtaactacatttcccgtgtggtggctgtcattggc
cctgacaactccgagtctgtcatgactgtggccaacttcctctccctatttctccttcca
cagatcacctacagcgccatcagcgatgagctgcgagacaaggtgcgcttcccggctttg
ctgcgtaccacacccagcgccgaccaccacatcgaggccatggtgcagctgatgctgcac
ttccgctggaactggatcattgtgctggtgagcagcgacacctatggccgcgacaatggc
cagctgcttggcgagcgcgtggcccggcgcgacatctgcatcgccttccaggagacgctg
cccacactgcagcccaaccagaacatgacgtcagaggagcgccagcgcctggtgaccatt
gtggacaagctgcagcagagcacagcgcgcgtcgtggtcgtgttctcgcccgacctgacc
ctgtaccacttcttcaatgaggtgctgcgccagaacttcactggcgccgtgtggatcgcc
tccgagtcctgggccatcgacccggtcctgcacaacctcacggagctgcgccacttgggc
accttcctgggcatcaccatccagagcgtgcccatcccgggcttcagtgagttccgcgag
tggggcccacaggctgggccgccacccctcagcaggaccagccagagctatacctgcaac
caggagtgcgacaactgcctgaacgccaccttgtccttcaacaccattctcaggctctct
ggggagcgtgtcgtctacagcgtgtactctgcggtctatgctgtggcccatgccctgcac
agcctcctcggctgtgacaaaagcacctgcaccaagagggtggtctacccctggcagctg
cttgaggagatctggaaggtcaacttcactctcctggaccaccaaatcttcttcgacccg
caaggggacgtggctctgcacttggagattgtccagtggcaatgggaccggagccagaat
cccttccagagcgtcgcctcctactaccccctgcagcgacagctgaagaacatccaagac
atctcctggcacaccatcaacaacacgatccctatgtccatgtgttccaagaggtgccag
tcagggcaaaagaagaagcctgtgggcatccacgtctgctgcttcgagtgcatcgactgc
cttcccggcaccttcctcaaccacactgaagatgaatatgaatgccaggcctgcccgaat
aacgagtggtcctaccagagtgagacctcctgcttcaagcggcagctggtcttcctggaa
tggcatgaggcacccaccatcgctgtggccctgctggccgccctgggcttcctcagcacc
ctggccatcctggtgatattctggaggcacttccagacacccatagttcgctcggctggg
ggccccatgtgcttcctgatgctgacactgctgctggtggcatacatggtggtcccggtg
tacgtggggccgcccaaggtctccacctgcctctgccgccaggccctctttcccctctgc
ttcacaatctgcatctcctgtatcgccgtgcgttctttccagatcgtctgcgccttcaag
atggccagccgcttcccacgcgcctacagctactgggtccgctaccaggggccctacgtc
tctatggcatttatcacggtactcaaaatggtcattgtggtaattggcatgctggccacg
ggcctcagtcccaccacccgtactgaccccgatgaccccaagatcacaattgtctcctgt
aaccccaactaccgcaacagcctgctgttcaacaccagcctggacctgctgctctcagtg
gtgggtttcagcttcgcctacatgggcaaagagctgcccaccaactacaacgaggccaag
ttcatcaccctcagcatgaccttctatttcacctcatccgtctccctctgcaccttcatg
tctgcctacagcggggtgctggtcaccatcgtggacctcttggtcactgtgctcaacctc
ctggccatcagcctgggctacttcggccccaagtgctacatgatcctcttctacccggag
cgcaacacgcccgcctacttcaacagcatgatccagggctacaccatgaggagggactag

  All links  
No link information was found.   
DBGET integrated database retrieval system