KEGG   Homo sapiens (human): 80835Help
Entry
80835             CDS       T01001                                 

Gene name
TAS1R1, GPR70, T1R1, TR1
Definition
taste receptor, type 1, member 1
Orthology
K04624  
taste receptor type 1 member 1
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    80835 (TAS1R1)
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Chemoreception
   Taste type 1
    80835 (TAS1R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.23
AA seq 841 aa AA seqDB search
MLLCTARLVGLQLLISCCWAFACHSTESSPDFTLPGDYLLAGLFPLHSGCLQVRHRPEVT
LCDRSCSFNEHGYHLFQAMRLGVEEINNSTALLPNITLGYQLYDVCSDSANVYATLRVLS
LPGQHHIELQGDLLHYSPTVLAVIGPDSTNRAATTAALLSPFLVPMISYAASSETLSVKR
QYPSFLRTIPNDKYQVETMVLLLQKFGWTWISLVGSSDDYGQLGVQALENQATGQGICIA
FKDIMPFSAQVGDERMQCLMRHLAQAGATVVVVFSSRQLARVFFESVVLTNLTGKVWVAS
EAWALSRHITGVPGIQRIGMVLGVAIQKRAVPGLKAFEEAYARADKKAPRPCHKGSWCSS
NQLCRECQAFMAHTMPKLKAFSMSSAYNAYRAVYAVAHGLHQLLGCASGACSRGRVYPWQ
LLEQIHKVHFLLHKDTVAFNDNRDPLSSYNIIAWDWNGPKWTFTVLGSSTWSPVQLNINE
TKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGTFLNKSDLYRCQPCG
KEEWAPEGSQTCFPRTVVFLALREHTSWVLLAANTLLLLLLLGTAGLFAWHLDTPVVRSA
GGRLCFLMLGSLAAGSGSLYGFFGEPTRPACLLRQALFALGFTIFLSCLTVRSFQLIIIF
KFSTKVPTFYHAWVQNHGAGLFVMISSAAQLLICLTWLVVWTPLPAREYQRFPHLVMLEC
TETNSLGFILAFLYNGLLSISAFACSYLGKDLPENYNEAKCVTFSLLFNFVSWIAFFTTA
SVYDGKYLPAANMMAGLSSLSSGFGGYFLPKCYVILCRPDLNSTEHFQASIQDYTRRCGS
T
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgctgctctgcacggctcgcctggtcggcctgcagcttctcatttcctgctgctgggcc
tttgcctgccatagcacggagtcttctcctgacttcaccctccccggagattacctcctg
gcaggcctgttccctctccattctggctgtctgcaggtgaggcacagacccgaggtgacc
ctgtgtgacaggtcttgtagcttcaatgagcatggctaccacctcttccaggctatgcgg
cttggggttgaggagataaacaactccacggccctgctgcccaacatcaccctggggtac
cagctgtatgatgtgtgttctgactctgccaatgtgtatgccacgctgagagtgctctcc
ctgccagggcaacaccacatagagctccaaggagaccttctccactattcccctacggtg
ctggcagtgattgggcctgacagcaccaaccgtgctgccaccacagccgccctgctgagc
cctttcctggtgcccatgattagctatgcggccagcagcgagacgctcagcgtgaagcgg
cagtatccctctttcctgcgcaccatccccaatgacaagtaccaggtggagaccatggtg
ctgctgctgcagaagttcgggtggacctggatctctctggttggcagcagtgacgactat
gggcagctaggggtgcaggcactggagaaccaggccactggtcaggggatctgcattgct
ttcaaggacatcatgcccttctctgcccaggtgggcgatgagaggatgcagtgcctcatg
cgccacctggcccaggccggggccaccgtcgtggttgttttttccagccggcagttggcc
agggtgtttttcgagtccgtggtgctgaccaacctgactggcaaggtgtgggtcgcctca
gaagcctgggccctctccaggcacatcactggggtgcccgggatccagcgcattgggatg
gtgctgggcgtggccatccagaagagggctgtccctggcctgaaggcgtttgaagaagcc
tatgcccgggcagacaagaaggcccctaggccttgccacaagggctcctggtgcagcagc
aatcagctctgcagagaatgccaagctttcatggcacacacgatgcccaagctcaaagcc
ttctccatgagttctgcctacaacgcataccgggctgtgtatgcggtggcccatggcctc
caccagctcctgggctgtgcctctggagcttgttccaggggccgagtctacccctggcag
cttttggagcagatccacaaggtgcatttccttctacacaaggacactgtggcgtttaat
gacaacagagatcccctcagtagctataacataattgcctgggactggaatggacccaag
tggaccttcacggtcctcggttcctccacatggtctccagttcagctaaacataaatgag
accaaaatccagtggcacggaaaggacaaccaggtgcctaagtctgtgtgttccagcgac
tgtcttgaagggcaccagcgagtggttacgggtttccatcactgctgctttgagtgtgtg
ccctgtggggctgggaccttcctcaacaagagtgacctctacagatgccagccttgtggg
aaagaagagtgggcacctgagggaagccagacctgcttcccgcgcactgtggtgtttttg
gctttgcgtgagcacacctcttgggtgctgctggcagctaacacgctgctgctgctgctg
ctgcttgggactgctggcctgtttgcctggcacctagacacccctgtggtgaggtcagca
gggggccgcctgtgctttcttatgctgggctccctggcagcaggtagtggcagcctctat
ggcttctttggggaacccacaaggcctgcgtgcttgctacgccaggccctctttgccctt
ggtttcaccatcttcctgtcctgcctgacagttcgctcattccaactaatcatcatcttc
aagttttccaccaaggtacctacattctaccacgcctgggtccaaaaccacggtgctggc
ctgtttgtgatgatcagctcagcggcccagctgcttatctgtctaacttggctggtggtg
tggaccccactgcctgctagggaataccagcgcttcccccatctggtgatgcttgagtgc
acagagaccaactccctgggcttcatactggccttcctctacaatggcctcctctccatc
agtgcctttgcctgcagctacctgggtaaggacttgccagagaactacaacgaggccaaa
tgtgtcaccttcagcctgctcttcaacttcgtgtcctggatcgccttcttcaccacggcc
agcgtctacgacggcaagtacctgcctgcggccaacatgatggctgggctgagcagcctg
agcagcggcttcggtgggtattttctgcctaagtgctacgtgatcctctgccgcccagac
ctcaacagcacagagcacttccaggcctccattcaggactacacgaggcgctgcggctcc
acctga

DBGET integrated database retrieval system