KEGG   Homo sapiens (human): 8085Help
Entry
8085              CDS       T01001                                 

Gene name
KMT2D, AAD10, ALR, CAGL114, KABUK1, KMS, MLL2, MLL4, TNRC21
Definition
lysine (K)-specific methyltransferase 2D (EC:2.1.1.43)
Orthology
K09187  
histone-lysine N-methyltransferase MLL2 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Disease
H00570  
Kabuki syndrome
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.12
AA seq 5537 aa AA seqDB search
MDSQKLAGEDKDSEPAADGPAASEDPSATESDLPNPHVGEVSVLSSGSPRLQETPQDCSG
GPVRRCALCNCGEPSLHGQRELRRFELPFDWPRCPVVSPGGSPGPNEAVLPSEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRLGA
SIPCRSPGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGAAYLEEARCAVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRVCRACGAGSAELNPNSEWFENYSLCHRCHKAQGGQTIRS
VAEQHTPVCSRFSPPEPGDTPTDEPDALYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLG
KAGVQLEPQLEAPLNEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPPEELPASPLP
EALHLSRPLEESPLSPPPEESPLSPPPESSPFSPLEESPLSPPEESPPSPALETPLSPPP
EASPLSPPFEESPLSPPPEELPTSPPPEASRLSPPPEESPMSPPPEESPMSPPPEASRLF
PPFEESPLSPPPEESPLSPPPEASRLSPPPEDSPMSPPPEESPMSPPPEVSRLSPLPVVS
RLSPPPEESPLSPPPEESPTSPPPEASRLSPPPEDSPTSPPPEDSPASPPPEDSLMSLPL
EESPLLPLPEEPQLCPRSEGPHLSPRPEEPHLSPRPEEPHLSPQAEEPHLSPQPEEPCLC
AVPEEPHLSPQAEGPHLSPQPEELHLSPQTEEPHLSPVPEEPCLSPQPEESHLSPQSEEP
CLSPRPEESHLSPELEKPPLSPRPEKPPEEPGQCPAPEELPLFPPPGEPSLSPLLGEPAL
SEPGEPPLSPLPEELPLSPSGEPSLSPQLMPPDPLPPPLSPIITAAAPPALSPLGELEYP
FGAKGDSDPESPLAAPILETPISPPPEANCTDPEPVPPMILPPSPGSPVGPASPILMEPL
PPQCSPLLQHSLVPQNSPPSQCSPPALPLSVPSPLSPIGKVVGVSDEAELHEMETEKVSE
PECPALEPSATSPLPSPMGDLSCPAPSPAPALDDFSGLGEDTAPLDGIDAPGSQPEPGQT
PGSLASELKGSPVLLDPEELAPVTPMEVYPECKQTAGQGSPCEEQEEPRAPVAPTPPTLI
KSDIVNEISNLSQGDASASFPGSEPLLGSPDPEGGGSLSMELGVSTDVSPARDEGSLRLC
TDSLPETDDSLLCDAGTAISGGKAEGEKGRRRSSPARSRIKQGRSSSFPGRRRPRGGAHG
GRGRGRARLKSTASSIETLVVADIDSSPSKEEEEEDDDTMQNTVVLFSNTDKFVLMQDMC
VVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEVCGQASDPS
RLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAASPGFHCEWQNSYTHCGP
CASLVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQAADEGFDCVSCQPYV
VKPVAPVAPPELVPMKVKEPEPQYFRFEGVWLTETGMALLRNLTMSPLHKRRQRRGRLGL
PGEAGLEGSEPSDALGPDDKKDGDLDTDELLKGEGGVEHMECEIKLEGPVSPDVEPGKEE
TEESKKRKRKPYRPGIGGFMVRQRKSHTRTKKGPAAQAEVLSGDGQPDEVIPADLPAEGA
VEQSLAEGDEKKKQQRRGRKKSKLEDMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFG
LGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDP
EKPGTPGEGMLSSDLDRISTEELPKMESKDLQQLFKDVLGSEREQHLGCGTPGLEGSRTP
LQRPFLQGGLPLGNLPSSSPMDSYPGLCQSPFLDSRERGGFFSPEPGEPDSPWTGSGGTT
PSTPTTPTTEGEGDGLSYNQRSLQRWEKDEELGQLSTISPVLYANINFPNLKQDYPDWSS
RCKQIMKLWRKVPAADKAPYLQKAKDNRAAHRINKVQKQAESQINKQTKVGDIARKTDRP
ALHLRIPPQPGALGSPPPAAAPTIFIGSPTTPAGLSTSADGFLKPPAGSVPGPDSPGELF
LKLPPQVPAQVPSQDPFGLAPAYPLEPRFPTAPPTYPPYPSPTGAPAQPPMLGASSRPGA
GQPGEFHTTPPGTPRHQPSTPDPFLKPRCPSLDNLAVPESPGVGGGKASEPLLSPPPFGE
SRKALEVKKEELGASSPSYGPPNLGFVDSPSSGTHLGGLELKTPDVFKAPLTPRASQVEP
QSPGLGLRPQEPPPAQALAPSPPSHPDIFRPGSYTDPYAQPPLTPRPQPPPPESCCALPP
RSLPSDPFSRVPASPQSQSSSQSPLTPRPLSAEAFCPSPVTPRFQSPDPYSRPPSRPQSR
DPFAPLHKPPRPQPPEVAFKAGSLAHTSLGAGGFPAALPAGPAGELHAKVPSGQPPNFVR
SPGTGAFVGTPSPMRFTFPQAVGEPSLKPPVPQPGLPPPHGINSHFGPGPTLGKPQSTNY
TVATGNFHPSGSPLGPSSGSTGESYGLSPLRPPSVLPPPAPDGSLPYLSHGASQRSGITS
PVEKREDPGTGMGSSLATAELPGTQDPGMSGLSQTELEKQRQRQRLRELLIRQQIQRNTL
RQEKETAAAAAGAVGPPGSWGAEPSSPAFEQLSRGQTPFAGTQDKSSLVGLPPSKLSGPI
LGPGSFPSDDRLSRPPPPATPSSMDVNSRQLVGGSQAFYQRAPYPGSLPLQQQQQQLWQQ
QQATAATSMRFAMSARFPSTPGPELGRQALGSPLAGISTRLPGPGEPVPGPAGPAQFIEL
RHNVQKGLGPGGTPFPGQGPPQRPRFYPVSEDPHRLAPEGLRGLAVSGLPPQKPSAPPAP
ELNNSLHPTPHTKGPTLPTGLELVNRPPSSTELGRPNPLALEAGKLPCEDPELDDDFDAH
KALEDDEELAHLGLGVDVAKGDDELGTLENLETNDPHLDDLLNGDEFDLLAYTDPELDTG
DKKDIFNEHLRLVESANEKAEREALLRGVEPGPLGPEERPPPAADASEPRLASVLPEVKP
KVEEGGRHPSPCQFTIATPKVEPAPAANSLGLGLKPGQSMMGSRDTRMGTGPFSSSGHTA
EKASFGATGGPPAHLLTPSPLSGPGGSSLLEKFELESGALTLPGGPAASGDELDKMESSL
VASELPLLIEDLLEHEKKELQKKQQLSAQLQPAQQQQQQQQQHSLLSAPGPAQAMSLPHE
GSSPSLAGSQQQLSLGLAGARQPGLPQPLMPTQPPAHALQQRLAPSMAMVSNQGHMLSGQ
HGGQAGLVPQQSSQPVLSQKPMGTMPPSMCMKPQQLAMQQQLANSFFPDTDLDKFAAEDI
IDPIAKAKMVALKGIKKVMAQGSIGVAPGMNRQQVSLLAQRLSGGPSSDLQNHVAAGSGQ
ERSAGDPSQPRPNPPTFAQGVINEADQRQYEEWLFHTQQLLQMQLKVLEEQIGVHRKSRK
ALCAKQRTAKKAGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHTNLMAEYRNKQQ
QQQQQQQQQQQQHSAVLALSPSQSPRLLTKLPGQLLPGHGLQPPQGPPGGQAGGLRLTPG
GMALPGQPGGPFLNTALAQQQQQQHSGGAGSLAGPSGGFFPGNLALRSLGPDSRLLQERQ
LQLQQQRMQLAQKLQQQQQQQQQQQHLLGQVAIQQQQQQGPGVQTNQALGPKPQGLMPPS
SHQGLLVQQLSPQPPQGPQGMLGPAQVAVLQQQHPGALGPQGPHRQVLMTQSRVLSSPQL
AQQGQGLMGHRLVTAQQQQQQQQHQQQGSMAGLSHLQQSLMSHSGQPKLSAQPMGSLQQL
QQQQQLQQQQQLQQQQQQQLQQQQQLQQQQLQQQQQQQQLQQQQQQQLQQQQQQLQQQQQ
QQQQQFQQQQQQQQMGLLNQSRTLLSPQQQQQQQVALGPGMPAKPLQHFSSPGALGPTLL
LTGKEQNTVDPAVSSEATEGPSTHQGGPLAIGTTPESMATEPGEVKPSLSGDSQLLLVQP
QPQPQPSSLQLQPPLRLPGQQQQQVSLLHTAGGGSHGQLGSGSSSEASSVPHLLAQPSVS
LGDQPGSMTQNLLGPQQPMLERPMQNNTGPQPPKPGPVLQSGQGLPGVGIMPTVGQLRAQ
LQGVLAKNPQLRHLSPQQQQQLQALLMQRQLQQSQAVRQTPPYQEPGTQTSPLQGLLGCQ
PQLGGFPGPQTGPLQELGAGPRPQGPPRLPAPPGALSTGPVLGPVHPTPPPSSPQEPKRP
SQLPSPSSQLPTEAQLPPTHPGTPKPQGPTLEPPPGRVSPAAAQLADTLFSKGLGPWDPP
DNLAETQKPEQSSLVPGHLDQVNGQVVPEASQLSIKQEPREEPCALGAQSVKREANGEPI
GAPGTSNHLLLAGPRSEAGHLLLQKLLRAKNVQLSTGRGSEGLRAEINGHIDSKLAGLEQ
KLQGTPSNKEDAAARKPLTPKPKRVQKASDRLVSSRKKLRKEDGVRASEALLKQLKQELS
LLPLTEPAITANFSLFAPFGSGCPVNGQSQLRGAFGSGALPTGPDYYSQLLTKNNLSNPP
TPPSSLPPTPPPSVQQKMVNGVTPSEELGEHPKDAASARDSERALRDTSEVKSLDLLAAL
PTPPHNQTEDVRMESDEDSDSPDSIVPASSPESILGEEAPRFPHLGSGRWEQEDRALSPV
IPLIPRASIPVFPDTKPYGALGLEVPGKLPVTTWEKGKGSEVSVMLTVSAAAAKNLNGVM
VAVAELLSMKIPNSYEVLFPESPARAGTEPKKGEAEGPGGKEKGLEGKSPDTGPDWLKQF
DAVLPGYTLKSQLDILSLLKQESPAPEPPTQHSYTYNVSNLDVRQLSAPPPEEPSPPPSP
LAPSPASPPTEPLVELPTEPLAEPPVPSPLPLASSPESARPKPRARPPEEGEDSRPPRLK
KWKGVRWKRLRLLLTIQKGSGRQEDEREVAEFMEQLGTALRPDKVPRDMRRCCFCHEEGD
GATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGA
TSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPMHKIKGPCEQELSSFAVFRRVYIERD
EVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQMADFHSATALYPVGYEATRIYWSLR
TNNRRCCYRCSIGENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADM
LRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLMELPLMINPTGCAR
SEPKILTHYKRPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVY
LARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHV
IDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQ
HKIPCHCGAWNCRKWMN
NT seq 16614 nt NT seq  +upstreamnt  +downstreamnt
atggacagccagaagctggctggtgaggataaagattcagaaccggcagctgatggacct
gcagcttctgaggacccaagtgccactgagtcagacctgcccaacccacatgtgggagag
gtctctgtccttagttctgggagtcccaggcttcaggagactcctcaggactgcagtggg
ggtccggtgcggcgttgtgctctctgtaactgcggggagcccagtctacacgggcagcgg
gagctacggcgctttgagttgccatttgattggccccggtgtccagtggtgtcccctggg
gggagcccagggcccaatgaggcagtgctgcccagtgaggacctatcacagattggtttc
cctgagggccttacacctgcccacctaggagaacctggagggtcctgctgggctcaccat
tggtgtgctgcatggtcggcaggcgtatgggggcaggagggcccagaactatgtggtgtg
gacaaggccatcttctcagggatctcacagcgctgctcccactgcaccaggctcggtgcc
tccatcccttgccgctcacctggatgtccacggctttaccacttcccctgcgcgactgcc
agcggttccttcctatccatgaaaacactgcagctgctatgcccagagcacagtgagggg
gctgcatatctggaggaggctcgctgtgcagtgtgtgaggggccaggggagttgtgtgac
ctgttcttctgtaccagctgtgggcatcactatcacggggcctgcctggacactgctctg
actgcccgcaaacgtgctggctggcagtgccctgaatgcaaagtgtgccaagcctgcagg
aaacctgggaatgactctaagatgttggtttgtgagacgtgtgacaaaggataccatact
ttctgcctaaaaccacccatggaggaactgcctgctcactcttggaagtgcaaggcgtgc
cgggtgtgccgggcctgtggggcgggctcagcagaactgaatcccaactcggagtggttt
gagaactactctctctgtcaccgctgtcacaaagcccagggaggtcagactatccgctcc
gttgctgagcagcataccccggtgtgtagcagattttcacccccagagcctggcgatacc
cccactgacgagcccgatgctctgtacgttgcatgccaagggcagccaaagggtgggcac
gtgacctctatgcaacccaaggaaccagggcccctgcaatgtgaagccaaaccactaggg
aaagcaggggtccaacttgagccccagttggaggcccccctaaacgaggagatgccactg
ctgcccccacctgaggagtcacccctgtccccaccacctgaggaatcacccacgtcccca
ccacctgaggcatcacgcctgtcaccaccacctgaggaattgcccgcatccccacttcct
gaggcattgcacctgtcccggccgctggaggaatcgcccctctctccgccgcctgaggag
tctcctctgtctcccccacctgaatcatcacctttttctccactggaggagtcgcccttg
tctccaccggaagagtcacccccatctcctgcacttgagacgcctctatccccaccacct
gaagcatcgcccctgtccccaccatttgaagaatctcctttgtccccgccacctgaggaa
ttgcccacttccccgccacctgaagcatctcgcctgtctccaccacctgaggagtcaccc
atgtcccctccacctgaagagtcacccatgtctccaccaccggaggcatctcgtctgttc
ccaccatttgaagagtctcctctgtcccctccacctgaggagtctcccctttccccacca
cctgaggcatcacgcctgtccccaccacctgaggactcgcctatgtccccaccacctgaa
gaatcacctatgtcccccccacctgaggtatcgcgcctatcccccctgcctgtggtgtca
cgcctgtctccaccgcctgaggaatctcccttgtccccaccgcctgaggagtctcccacg
tcccctccacctgaggcttcacgcctctccccaccacctgaggactcccccacatcccca
ccacctgaggactcacctgcttccccaccaccggaggactcgctcatgtccctgccgctg
gaggagtcacccctgttgccactacctgaggagccgcaactctgcccccggtccgagggg
ccgcacctgtcaccccggcctgaggagccgcacctgtccccccggcctgaggagccacac
ctatctccgcaggctgaggagccacacctgtccccccagcctgaggagccatgcctatgc
gctgtgcctgaggagccacacttgtccccccaggctgagggaccacatctgtcccctcag
cctgaggaattgcacctgtccccccagactgaggagccgcacctgtctcctgtgcctgag
gagccatgcttgtccccccaacctgaggaatcacacctgtccccccagtctgaggagcca
tgcctgtccccccggcctgaggaatcgcatctgtcccctgagcttgagaagccacccctg
tcccctcggcctgaaaagccccctgaggagccaggccaatgccctgcacctgaggagctg
cccttgttccctccccctggggaaccatccttatctcccttgcttggagagccagccctg
tctgagcctggggaaccacctctgtcccctctgcccgaggagctgccgttgtccccatct
ggggagccatccttgtcgcctcagctgatgccaccagatccccttcctcctccactctca
cccatcatcacagctgcggccccaccggccctgtctcctttgggggagttagagtacccc
tttggtgccaaaggggacagtgaccctgagtcaccgttggctgcccccatcctggagaca
cccatcagccctccaccagaagctaactgcactgaccctgagcctgtcccccctatgatc
cttcccccatctccaggctccccagtggggccggcttctcccatcctgatggagcccctt
cctcctcagtgttcgccactccttcagcattccctggttccccaaaactcccctccttcc
cagtgctctcctcctgccctaccactgtccgttccctccccgttgagtcccatagggaag
gtagtgggggtctcagatgaggctgagctgcacgagatggagactgagaaagtttcagaa
cctgaatgcccagccttggaacccagtgccaccagtcctctcccttccccaatgggggac
ctttcctgccccgcccccagccctgccccagccctggatgacttctctggcctaggggaa
gacacagcccctctggatgggattgatgctccgggttcacagccagagcctggacagacc
cctggcagtttggctagtgaacttaaaggctcccctgtgctcctggaccccgaggagctg
gcccctgtgacccctatggaggtctaccccgaatgcaagcagacagcagggcagggctca
ccatgtgaagaacaggaagagccacgtgcaccggtggcccccacaccacccactctcatc
aaatccgacatcgttaacgagatctctaatctgagccagggtgatgccagtgccagtttt
cctggctcagagcccctcctgggctctccagacccggaggggggtggctccctgtccatg
gagttgggggtctctacggatgttagtccagcccgagatgagggctccctacggctctgt
actgactcactgccagagactgatgactcactattgtgcgatgctgggacagctatcagc
ggaggcaaagctgagggggagaaggggcggcggcgcagctccccagcccgttcccgcatc
aaacagggtcgcagcagcagtttcccaggaagacgccggcctcgtggaggagcccatgga
ggacgtggtagaggacgggcccggctaaagtcaactgcttcttccattgagactctggta
gttgctgacattgatagctctcccagtaaggaggaggaggaagaagatgatgacaccatg
cagaataccgtggttctcttctccaacacagacaaatttgtcctaatgcaggacatgtgt
gtggtatgtggcagctttggccggggggcagagggccacctccttgcctgttcgcagtgc
tctcagtgctatcacccttactgtgtcaacagcaagatcaccaaggtgatgctgctcaag
ggctggcgttgtgtggagtgtattgtgtgtgaggtgtgtggccaggcctccgacccctca
cgcctgctgctctgtgatgactgtgatattagctaccacacatactgcctggacccccca
ctgctcaccgtccccaagggcggctggaagtgcaagtggtgtgtgtcctgtatgcagtgt
ggggctgcttcccctggcttccactgtgaatggcagaatagttacacacactgtgggccc
tgtgccagcctggtgacctgccctatctgtcatgctccttacgtagaagaggacctacta
atccagtgccgccactgtgaacggtggatgcatgcaggctgtgagagcctcttcacagag
gacgatgtggagcaggcagccgatgaaggctttgactgtgtctcctgccagccctacgtg
gtaaagcctgtggcgcctgttgcacctccagagctggtgcccatgaaggtgaaagagcca
gagccccagtactttcgcttcgaaggtgtgtggctgacagaaactggcatggccttgctg
cgtaacctgaccatgtcaccactgcacaagcggcgccaacggcgaggacggcttggcctc
ccaggcgaggcaggattggagggttctgagccctcagatgcccttggccctgatgacaag
aaggatggggacctggacaccgatgagctgctcaagggtgaaggtggtgtggagcacatg
gagtgcgaaattaaactggagggccccgtcagccctgatgtggagcctggcaaagaggag
accgaggaaagcaaaaaacgcaagcgtaaaccatatcggcctggcattggtggtttcatg
gtgcgacagcggaaatcccacacacgcacgaaaaaggggcctgctgcacaggcggaggtg
ttgagtggggatgggcagcccgacgaggtgatacctgctgacctgcctgcagagggcgcc
gtggagcagagcttagctgaaggggatgagaagaagaagcaacagcggcgagggcgcaag
aagagcaaactggaggacatgttccctgcttacttgcaggaagccttctttgggaaggag
ctgctggacctgagccgtaaggccctttttgcagttggggtgggccggccaagctttgga
ctagggaccccaaaagccaagggagatggaggctcagaaaggaaggaactccccacatcg
cagaaaggagatgatggtccagatattgcagatgaagaatcccgtggcctcgagggcaaa
gccgatacaccaggacctgaggatgggggcgtgaaggcatccccagtgcccagtgaccct
gagaagccaggcaccccaggtgaagggatgcttagctctgacttagacaggatttccaca
gaagaactgcccaagatggaatccaaggacctgcagcagctcttcaaggatgttctgggc
tctgaacgagaacagcatctgggttgtggaacccctggcctagaaggcagccgtacgcca
ctgcagaggccctttcttcaaggtggactccctttgggcaatctgccctccagcagccca
atggactcctacccaggcctctgccagtccccgttcctggattctagggagcgcgggggc
ttctttagcccggaacccggtgagcccgacagcccctggacgggctcaggtggcaccacg
ccctccacccccacaacccccaccacggagggtgagggcgacggactctcctataaccag
cggagtcttcagcgctgggagaaggatgaggagttgggccagctgtccaccatctcacct
gtgctctatgccaacattaattttcctaatctcaagcaagactacccagactggtcaagc
cgttgcaaacaaatcatgaagctctggagaaaggttccagcagctgacaaagccccctac
ctgcaaaaggccaaagataaccgggcagctcaccgcatcaacaaggtgcagaagcaggct
gagagccagatcaacaagcagaccaaggtgggcgacatagcccgtaagactgaccgaccg
gccctacatctccgcattcccccgcagccaggggcactgggcagcccgccccccgctgct
gcccccaccattttcattggcagccccactacccccgccggcttgtctacctctgcggac
gggttcctgaagccgccggcgggctcggtgcctggccctgactcgcctggtgagctcttc
ctcaagctcccaccccaggtgcccgcccaagtgccttcgcaggacccctttggactggcc
cctgcctatcccctggagccccgcttccccacggcaccgcccacctatcccccctatcct
agtcctacgggggcccctgcgcagcccccgatgctgggcgcctcatctcgtcctggggct
ggccagccaggggaattccacactaccccacctggcacccccagacaccagccctccaca
cctgacccattcctcaaaccccgctgcccctcgctggataacttggctgtgcctgagagc
cctggggtagggggaggcaaagcttccgagcccctgctctcgcccccaccttttggggag
tcccggaaggccctagaggtgaagaaggaagagcttggggcatcctctcctagctatggg
cccccaaacctgggctttgttgactcaccctcctcaggcacccacctgggtggcctggag
ttaaagacacctgatgtcttcaaagcccccctgacccctcgggcatctcaggtagagccc
cagagcccgggcttgggcctaaggccccaggagccaccccctgcccaggctttggcacct
tctcctccaagtcacccagacatctttcgccctggctcctacactgacccatatgctcag
cccccattgactcctcggccccaacctccgccccctgagagctgctgtgctctgccccct
cgctcactgccctccgaccctttctcccgagtgcctgccagtcctcagtcccagtccagc
tcccagtctccactgacaccccggcctctgtctgctgaagctttttgcccatcacccgtt
acccctcgcttccagtcccctgacccttattctcgcccaccctcacgccctcagtcccgt
gacccatttgccccattgcataagccaccccgaccccagccccctgaagttgcctttaag
gctgggtctctagcccacacttcgctgggggctggggggttcccagcagccctgcccgcg
gggccagcaggtgagctccatgccaaggtcccaagtgggcagccccccaattttgtccgg
tcccctgggacgggtgcatttgtgggcaccccctctcccatgcgtttcactttccctcag
gcagtaggggagccttccctaaagccccctgtccctcagcctggtctcccgccaccccat
gggatcaacagccattttgggcccggccccaccttgggcaagcctcaaagcacaaactac
acagtagccacagggaacttccacccatcgggcagccccctggggcccagcagcgggtcc
acaggggagagctatgggctgtccccactacgccctccgtcggttctgccaccacctgca
cccgacggatccctcccctacctgtcccatggagcctcacagcgatcaggcatcacctct
cctgtcgaaaagcgagaagacccagggactggaatgggtagctctttggcgacagctgaa
ctcccaggtacccaggacccaggcatgtccggccttagccaaacagagctggagaagcaa
cggcagcgccagcgactacgagagctgctgattcggcagcagatccagcgcaacaccctg
cggcaggagaaggaaacagctgcagcagctgcaggagcagtggggcctccaggcagctgg
ggtgctgagcccagcagccctgcctttgagcagctgagtcgaggccagaccccctttgct
gggacacaggacaagagcagccttgtggggttgcccccaagcaagctgagtggccccatc
ctggggccagggtccttccctagcgatgaccgactctcccggccacctccaccagccacg
ccttcctctatggatgtgaacagccggcaactggtaggaggctcccaagctttctatcag
cgagcaccctatcctgggtccctgcccttacagcagcaacagcaacaactgtggcagcaa
caacaggcaacagcagcaacctccatgcgatttgccatgtcagctcgctttccatcaact
cctggacctgaacttggccgccaagccctaggttccccgttggcgggaatttccacccgt
ctgccaggccctggtgagccagtgcctggtccagctggtcctgcccagttcattgagctg
cggcacaatgtacagaaaggactgggacctgggggcactccgtttcctggtcagggccca
cctcagagaccccgtttttaccctgtaagtgaggacccccaccgactggctcctgaaggg
cttcggggcctggcggtatcaggtcttcccccacagaaaccctcagccccaccggcccct
gaattgaacaacagtcttcatccaacaccccacaccaagggtcctaccctgccaactggt
ttggagctggtcaaccggcccccgtcgagcactgagcttggccgccccaatcctctggcc
ctggaagctgggaagttgccctgtgaggatcccgagctggatgacgattttgatgcccac
aaggccctagaggatgatgaagagcttgctcacctgggtctgggtgtggatgtggccaag
ggtgatgatgaacttggcaccttagaaaacctggagaccaatgacccccacttggatgac
ctgctcaatggagacgagtttgacctgctggcatatactgatcctgagctggacactggg
gacaagaaggatatcttcaatgagcacctgaggctggtagaatcggctaatgagaaggct
gaacgggaggccctgctgcggggggtggagccaggacccttgggccctgaggagcgccct
ccccctgctgctgatgcctctgaaccccgcctggcatctgtgctccctgaggtgaagccc
aaggtggaggagggtggacgccacccttctccttgccaattcaccattgctacccccaag
gtagagcccgcacctgctgccaattcccttggcctggggctaaagccaggacagagcatg
atgggcagccgggatacccggatgggcacagggccattttctagcagtgggcacacagct
gagaaggcctcctttggggccacgggaggaccaccagctcacctgctgacccccagccca
ctgagtggcccaggaggatcctccctgctggaaaagtttgagctcgagagtggggctttg
accttgcctggtggacctgcagcatctggggatgagctagacaagatggagagctcactg
gtagccagcgagttacccctgctcattgaggacctgttggagcatgagaagaaggagctg
cagaagaagcagcagctttcagcacagttgcagcctgcccagcagcagcagcaacagcag
cagcagcattccctactgtctgcaccaggccctgcccaggccatgtctttgccacatgag
ggctcttctcccagtttggctgggtcccaacagcagctttccctgggtcttgcaggtgcc
cgacagccaggtttgccccagccactgatgcccacccagccaccagctcatgccctccag
caacgcctggctccatccatggctatggtgtccaatcaagggcatatgctaagtgggcag
catggagggcaggcaggcttggtaccccagcagagctcacagccagtgctatcacagaag
cccatgggcaccatgccaccttccatgtgcatgaagccgcagcaattggcaatgcagcag
cagctggcaaacagcttcttcccagatacagacctggacaaatttgctgcagaagatatc
attgatcccattgcaaaggccaagatggtggctttgaaaggcatcaagaaagtgatggct
cagggcagcattggggtggcacctggtatgaacagacagcaagtgtctctgctagcccag
aggctctcggggggacctagcagtgatctgcagaaccatgtggcagctgggagtggccag
gagcggagtgctggtgatccctcccagcctcgtcccaacccgcccacttttgctcaggga
gtgatcaatgaagctgaccagcggcagtatgaggagtggctgttccatacccagcagctc
ctacagatgcagctgaaggtgctagaggagcagattggtgtacaccgcaagtcccggaag
gctctgtgtgccaagcagcgcactgccaaaaaagctggccgtgagttcccagaagctgat
gctgagaagctcaagctggttacagagcagcagagcaagatccagaaacaactggatcag
gtccggaaacagcagaaggagcacactaatctcatggcagaatatcggaacaagcagcag
caacaacagcagcagcagcagcaacaacagcaacagcactcagctgtgctggctctcagc
ccttcccagagtccccggctgctcaccaagctccctggtcagctgctccctggccatggg
ctgcagccaccacaggggcctccgggtgggcaagccggaggtcttcgcctgacccctggg
ggtatggcactacctggacagcctggtggccccttccttaatacagctctggcccaacag
cagcaacagcaacattctggtggggctggatccctggctggcccttcagggggcttcttc
cctggcaaccttgctcttcgaagcctcggacctgattcaaggcttttacaggaaaggcag
ctgcagctgcagcagcaacgtatgcagctggcccagaaactgcagcagcagcagcagcag
caacagcagcagcagcaccttctaggacaggtggcaatccagcagcaacagcagcagggt
cctggagtacagacaaaccaagctctgggtcccaagccccagggccttatgcctcccagc
agccaccaaggcctcctggtccagcagctgtcccctcaaccaccccaggggccccagggc
atgctgggccctgcccaggtggctgtgttgcagcagcagcaccctggagctttgggcccc
cagggccctcacagacaggtgcttatgacccagtcccgggtgctcagttccccccagctg
gcacagcagggtcagggccttatgggacacaggctggtcacagcccagcagcagcagcag
caacaacagcaccaacagcaagggtccatggcagggctgtcccatcttcagcagagtctg
atgtcacacagtgggcagcccaaactgagcgctcagcccatgggctctttacagcagctt
cagcagcagcagcagctgcaacagcaacagcaacttcagcagcagcagcagcagcagcta
caacagcaacagcaacttcagcagcaacagcttcaacagcagcaacagcagcagcagctt
caacaacagcagcagcaacagcttcaacagcagcaacagcagctacaacagcaacagcaa
caacaacagcagcagtttcaacagcagcagcaacagcagcagatgggccttttaaaccag
agtcgaactttactgtctcctcagcaacaacagcagcagcaagtggcacttggccctggc
atgccagcaaagcctcttcaacacttttctagccctggagccctgggtccaaccctcctc
ctgacgggcaaggaacaaaacaccgtagacccagccgtttcttcagaggccactgagggg
ccctctacacatcagggagggccgttagcaataggaactacccctgagtcaatggccact
gaaccaggagaggtaaagccctcactctctggggactcacaactcctgcttgtccaaccc
cagccccagcctcagcccagctctctgcagctgcagccacctctgaggcttccaggacaa
cagcagcagcaagttagcctgctccacacagcaggtggaggaagccatgggcagctaggc
agtggatcatcttctgaggcctcatctgtgccccacctgctggctcagccctctgtttcc
ttaggggatcagcctgggtccatgacccagaaccttctgggcccccaacagcccatgcta
gagcggcccatgcaaaataatacagggccacaacctcccaaaccaggacctgtcctccag
tctgggcagggtctgcctggggttggaatcatgcctacggtgggtcagcttcgagcacag
ctccaaggagtcctggccaaaaacccacagctgcggcacttaagtcctcagcagcagcag
cagctacaggcactcctcatgcagcggcagctgcagcagagtcaggcagtacgccagacc
ccaccctaccaggagcctgggacccagacctctcccctccagggcctcctgggctgccaa
cctcaacttgggggcttccctggaccacagacaggccccctccaggagctaggggcaggg
cctcgacctcagggcccaccccggctccctgccccaccaggagccttatctacaggacca
gtccttggccctgtccatcccacacctccaccatccagccctcaagagccaaagagacct
tcacaattaccttcccccagctcccagcttcccactgaggcccagctccctcccacccat
ccagggacccccaaacctcaggggccaaccttggagccgcctcctgggagggtctcacct
gctgctgcccagcttgcagataccttgtttagcaagggtctgggaccttgggatccccca
gacaacctagcagaaacccagaagccagagcagagcagcctggtacctgggcatctggac
caggtgaatggacaggtggtgcctgaggcatcccaactcagcatcaagcaggaacctcgg
gaagagccatgtgccctgggagcccagtcagtgaagagggaggccaatggggagccaata
ggggcaccaggaaccagcaaccacctcctgctggcaggccctcgctcagaagctgggcat
ctgctcttgcagaagctactccgggcaaagaatgtgcaactcagcactgggcgggggtcc
gaggggctgcgagctgagatcaacgggcacattgacagcaagctggctgggctggagcag
aaactacagggtacccccagcaacaaggaggatgcagcagcaaggaagcctttgacaccg
aagcccaagcgggtacagaaggcaagcgacaggttggtgagctcccgaaagaagctgcgg
aaggaggacggggtcagggccagcgaggccttgctgaaacagctgaaacaggagctgtcc
ctgctgcccctaacggagcctgctatcaccgccaattttagcctctttgccccctttggc
agtggctgcccagtcaatgggcagagccagctgaggggggcctttggaagtggggcgctg
cccactggccctgactactattcccagctgcttaccaagaataacctgagtaacccgccg
acaccaccctcgtcgctgccccccaccccacccccatcggtgcagcagaagatggtgaat
ggcgtcaccccatctgaagagctgggggagcaccccaaggatgctgcctctgcccgggat
agtgaaagggcactgagggatacttcagaggtgaagagtctagacctgctggctgccttg
cctacaccccctcacaatcagactgaggatgtcaggatggagagtgatgaggatagcgat
tctcctgacagcattgtgccagcttcatcccctgagagcatcttgggggaggaggcccct
cgtttccctcatctgggctcaggccggtgggagcaagaggaccgggccctctcccctgtc
atccccctcattcctcgggccagcatcccagtcttcccagataccaaaccttatggggcc
cttggcctggaggtccctggaaagctgcctgtcacaacttgggaaaagggcaaaggaagt
gaggtgtcagtcatgctcacagtctctgctgctgcagccaagaacctgaatggcgtgatg
gtggcagtggcggagctgctgagcatgaagatccccaactcctatgaggtgctgttccca
gagagccccgcccgggcaggcactgagccaaagaagggggaagctgagggtcctggtggg
aaggaaaagggtctggaaggcaagagcccagacactggccctgattggctgaagcagttt
gatgcagtgttgcctggctataccctgaagagccaactagacatcttgagcctcctgaaa
caggagagccccgccccagagccacccactcagcacagctatacctacaatgtctccaat
ctggatgtgcgacagctctcggccccacctcctgaagaaccctccccgcccccttccccc
ttggcaccttctcctgccagtccccctactgagcccttggttgaacttcccaccgaaccc
ttggctgagccacccgtcccctcacctctgccactggcctcatcccctgaatcagcccga
cccaagccccgtgcccggccccctgaagaaggtgaagattcccgtcctcctcgcctcaag
aaatggaaaggagtgcgctggaagcggcttcggctgctgctgaccatccagaagggcagt
gggcggcaggaggatgagcgggaagtggcagagtttatggagcagcttggcacagccttg
cgacctgacaaggtaccgcgagacatgcgtcgctgctgtttctgtcatgaggagggtgac
ggggccactgatgggcctgcccgtctgctgaacctggacctggacctgtgggtgcacctc
aactgtgccctttggtccacggaggtgtatgagacccagggcggggcactgatgaatgtg
gaggttgccctgcaccgaggactgctaaccaagtgctccctgtgccagcgaactggtgcc
accagcagctgcaatcgcatgcgttgccccaatgtctaccattttgcttgtgccatccgt
gccaagtgcatgttcttcaaggacaagaccatgctgtgtccaatgcataagatcaagggg
ccctgtgagcaagagctgagctcttttgctgtcttccggcgggtctacattgagcgggac
gaggtgaagcaaatcgctagcatcattcagcggggagaacggctgcacatgttccgtgtg
gggggccttgtgttccacgccatcggacagctgctgcctcaccagatggctgactttcat
agtgccactgccctctatcccgtgggctacgaggccacgcgcatctattggagcctccgc
accaacaatcgtcgctgctgctatcgctgttctattggtgagaacaacgggcggccggag
tttgtaatcaaagtcatcgagcagggcctggaggacctggtcttcactgacgcctctccc
caggccgtgtggaatcgcatcattgagcctgtggctgccatgagaaaagaggctgacatg
ctgcgactcttccctgagtatctgaagggcgaggagctctttgggctgacggtgcatgcc
gtgcttcgcatagctgaatcactgcccggggtggagagctgtcaaaactatttattccgc
tatgggcgccacccccttatggagctgccactcatgatcaaccccactggctgtgcccga
tcagagcctaaaatcctcacacactacaaacggccccataccctgaacagcaccagcatg
tctaaggcatatcagagcaccttcacaggcgagaccaacaccccctacagcaagcagttt
gtgcactccaagtcatctcagtaccggcggctgcgcaccgaatggaagaacaacgtgtac
ctggctcgctcccgtatccagggcctggggctctatgcagccaaggacctagaaaagcac
acaatggttatcgagtacattggcaccatcattcggaacgaggtggccaaccggcgggag
aaaatctacgaagagcagaatcgaggcatctacatgttccgaataaacaatgaacatgtg
attgatgctacgttgaccggcggccctgccaggtacattaaccattcctgtgcccctaac
tgtgtggccgaagtcgtgacatttgacaaagaggacaaaatcatcatcatctccagccgg
cgaatccccaaaggagaggagctaacctatgactatcagtttgattttgaggacgatcag
cacaagatcccctgccactgtggagcctggaattgtcggaaatggatgaactaa

DBGET integrated database retrieval system