KEGG   Homo sapiens (human): 80853Help
Entry
80853             CDS       T01001                                 

Gene name
KDM7A, JHDM1D
Definition
(RefSeq) lysine demethylase 7A
  KO
K11445  
lysine-specific demethylase 7A [EC:1.14.11.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     80853 (KDM7A)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    80853 (KDM7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q34
AA seq 941 aa AA seqDB search
MAGAAAAVAAGAAAGAAAAAVSVAAPGRASAPPPPPPVYCVCRQPYDVNRFMIECDICKD
WFHGSCVGVEEHHAVDIDLYHCPNCAVLHGSSLMKKRRNWHRHDYTEIDDGSKPVQAGTR
TFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVM
DVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVE
VPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKI
FYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQ
DCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELRED
GFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEENG
KPVKSQGIPIVCPVSRSSNEATSPYHSRRKMRKLRDHNVRTPSNLDILELHTREVLKRLE
MCPWEEDILSSKLNGKFNKHLQPSSTVPEWRAKDNDLRLLLTNGRIIKDERQPFADQSLY
TADSENEEDKRRTKKAKMKIEESSGVEGVEHEESQKPLNGFFTRVKSELRSRSSGYSDIS
ESEDSGPECTALKSIFTTEESESSGDEKKQEITSNFKEESNVMRNFLQKSQKPSRSEIPI
KRECPTSTSTEEEAIQGMLSMAGLHYSTCLQRQIQSTDCSGERNSLQDPSSCHGSNHEVR
QLYRYDKPVECGYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRV
QSRNYVDSSGSSLQNGKYMQNSNLTSGACQISNGSLSPERPVGETSFSVPLHPTKRPASN
PPPISNQATKGKRPKKGMATAKQRLGKILKLNRNGHARFFV
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggccggagcggcggcggcggtggccgcgggagcagcagctggagccgccgcggcagcc
gtgtcggtggcggctcccggccgggcctcggcgcctccgccgcccccgcccgtgtactgt
gtgtgccggcagccgtacgacgtgaaccgcttcatgatcgagtgcgatatctgcaaggac
tggttccacggcagctgtgttggagtagaagaacatcatgctgttgacattgacctgtat
cactgtcccaactgtgcagttttacatggttcctccttgatgaaaaaaaggaggaactgg
cacagacatgactacacagaaattgatgatggttccaaaccagtgcaagctggaactaga
actttcattaaggaattacgctctcgagtcttcccaagtgccgatgaaataattataaag
atgcatggcagccagctgacacaaagatatctggagaaacatggatttgatgtccctatt
atggtcccaaaattagatgatctaggactcaggctcccttcacctacattttctgtgatg
gatgtggaacgttatgtaggtggtgacaaagtgatagatgtcattgatgtggcgaggcag
gcagacagcaaaatgacacttcacaattatgttaaatacttcatgaatcctaacagacca
aaagtgttaaatgtgatcagccttgaattttcagatacaaagatgtctgaattggtggag
gtccctgatatagccaaaaaactttcctgggtggaaaattattggccagatgattcagtc
tttcccaagccatttgttcagaaatattgcttaatgggagttcaagacagctatacagat
ttccacattgacttcggtggaacttcagtctggtaccatgtcctctggggtgagaagatt
ttttatttaataaagccaacagatgaaaatttggcacgttatgaatcttggagttcatct
gtgacccagagtgaggtgttctttggagataaggtggataaatgctacaaatgtgtggta
aagcagggacataccttatttgttcctacagggtggatccatgctgtgctcacttctcag
gactgtatggcttttggggggaacttcctgcacaaccttaacattggcatgcagctcagg
tgttatgagatggagaaaaggctaaaaacaccagatcttttcaaattccctttctttgaa
gccatatgttggtttgtagccaaaaacttgctggaaaccctgaaagaactgagagaagat
ggtttccagcctcaaacttacctagtacagggagtgaaagcactgcatactgctttaaaa
ttatggatgaaaaaagaacttgtatctgaacatgcctttgaaattccagacaatgttaga
cctggacaccttattaaagaactttctaaagtaattcgagcaatagaggaggaaaacggc
aaaccagttaaatctcagggaattcctattgtgtgtccagtttcacgatcctcaaatgaa
gcaacttccccataccattcccgaagaaagatgaggaaacttcgagatcataatgtccga
actccttctaacctagacatcctagagctccacacaagggaggtcctcaaaagattagag
atgtgtccatgggaagaggacatcttgagctctaaactgaatggaaaattcaacaaacat
ctccaaccatcctccacagtacctgaatggagagcgaaagataatgatctacgattactg
ctgacaaatggaagaataattaaagatgaaaggcagccctttgcagatcaaagtctttat
acagcagatagtgaaaatgaagaggataaaagaaggacaaaaaaggcaaaaatgaagata
gaagagagttcaggagtagagggagtggaacatgaagaatctcaaaaaccactgaatggg
ttttttacacgtgtgaaatcagaactcaggagtagatcatcaggatattctgatatttct
gagtcagaagactccggacccgagtgcactgcactgaaaagtatctttaccactgaagag
tctgaaagttcaggtgatgaaaagaaacaagaaataacatccaactttaaggaggaatct
aatgtgatgaggaacttccttcaaaagagccagaagccatctagaagtgaaattccaatt
aaaagggaatgtcctacctcgacgagcacagaggaagaagctattcagggcatgctgtct
atggcagggttgcactattccacgtgtttacaaaggcaaatacaaagcacagactgcagt
ggtgaaagaaactctctccaggatcccagcagctgccatggcagtaaccatgaggttagg
cagttgtatcgctatgataaaccagtggaatgtggataccatgtcaagactgaagatcca
gacttgaggacttcctcctggattaaacagtttgatacttccagatttcatcctcaggat
ctaagtagaagccagaaatgcatcagaaaggaaggttcatcagaaattagtcagagggta
caaagtaggaattatgtggacagcagcggctcaagccttcagaatggaaagtatatgcag
aattcaaacctgacttcgggggcgtgccagataagtaatggcagtctaagcccagaaagg
ccagttggtgaaacttccttctcggtgccccttcaccccaccaagagaccggcatcaaat
ccaccacctatcagcaaccaggcaacaaaaggtaaacgtccaaaaaaaggaatggcaaca
gccaaacaacgtcttgggaagatccttaagttgaacagaaatggccatgcacgtttcttt
gtgtga

DBGET integrated database retrieval system